SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g06170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g06170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g06170

Feature Type:gene_model
Chromosome:Gm14
Start:4465250
stop:4468041
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G07090AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S4 (RPS4A) family protein | chr5:2202410-2203805 FORWARD LENGTH=262 SoyBaseE_val: 0ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG0378 KOG 40S ribosomal protein S4 JGI ISS
PTHR11581Panther 30S/40S RIBOSOMAL PROTEIN S4 JGI ISS
PF00467PFAM KOW motif JGI ISS
PF00900PFAM Ribosomal family S4e JGI ISS
PF01479PFAM S4 domain JGI ISS
PF08071PFAM RS4NT (NUC023) domain JGI ISS
UniRef100_Q8LJW0UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal S4 protein n=2 Tax=Glycine max RepID=Q8LJW0_SOYBN SoyBaseE_val: 0ISS
UniRef100_UPI00019AA891UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00019AA891 related cluster n=1 Tax=unknown RepID=UPI00019AA891 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g06170 not represented in the dataset

Glyma14g06170 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g43080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g056900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g06170.1   sequence type=CDS   gene model=Glyma14g06170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAGGGGACTAAAGAAGCATTTGAAAAGGCTCAATGCTCCTAAGCATTGGATGCTTGACAAACTGGGTGGTGCATTTGCGCCTAAACCCTCATCTGGACCACACAAATCGAGGGAGTGCCTCCCCCTCATTCTTATTCTGCGAAACCGGCTGAAGTATGCTCTGACATACCGTGAAGTCATTGCTATTCTGATGCAGCGCCATGTTCTTGTTGATGGCAAAGTCAGGACTGACAAGACTTACCCTGCTGGTTTCATGGATGTTGTTTCAATCCCAAAAACAAATGAGAACTTCCGCCTGCTCTATGACACTAAAGGCCGATTCCGTCTTCATTCCATCAGGGATGATGAGGCAAAGTTCAAGCTCTGCAAGGTTAGGTCAGTACAGTTTGGCCAGAAAGGTATCCCATACCTGAACACCTATGATGGTCGCACCATCCGTTACCCAGACCCTCTCATCAGGGCCAATGACACTGTTAAGCTGGATCTGGAGGAAAACAAGATTGTCGATTTTATCAAATTTGATGTTGGGAATGTAGTTATGGTAACAGGTGGAAGAAACAGGGGGCGTGTTGGAGTGATCAAGAACAGGGAGAAGCATAAGGGTAGCTTCGAGACAATTCACGTGCAGGATGCCACTGGGCATGAATTTGCTACTCGTATGGGCAATGTGTTCACTATTGGCAAGGGGACAAAGCCATGGATATCCCTGCCCAAGGGTAAGGGTATTAAGCTATCAATCATTGAAGAAGCTAGGAAAAGGATTGCCGCCCAGCAAGCAACTACTGCTTAA

>Glyma14g06170.1   sequence type=predicted peptide   gene model=Glyma14g06170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRIAAQQATTA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo