SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma14g05800

Feature Type:gene_model
Chromosome:Gm14
Start:4193950
stop:4196300
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G50460AT Annotation by Michelle Graham. TAIR10: secE/sec61-gamma protein transport protein | chr5:20552168-20552509 REVERSE LENGTH=69 SoyBaseE_val: 7.00E-40ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0006605GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0015450GO-mf Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity SoyBaseN/AISS
KOG3498 KOG Preprotein translocase, gamma subunit JGI ISS
PTHR12309Panther SEC61 GAMMA SUBUNIT JGI ISS
PF00584PFAM SecE/Sec61-gamma subunits of protein translocation complex JGI ISS
UniRef100_G7KH37UniRef Annotation by Michelle Graham. Best UniRef hit: Protein transport protein SEC61 gamma subunit n=3 Tax=Papilionoideae RepID=G7KH37_MEDTR SoyBaseE_val: 1.00E-40ISS
UniRef100_G7KH37UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein transport protein SEC61 gamma subunit n=3 Tax=Papilionoideae RepID=G7KH37_MEDTR SoyBaseE_val: 1.00E-40ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g42671 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g053200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g05800.3   sequence type=CDS   gene model=Glyma14g05800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACGCCATTGATTCTGTGTTCGATCCGTTGAGAGAATTCGCAAAGGACAGCGTGAGGCTCGTGAAGCGCTGCCACAAACCCGATCGCAAAGAATTCTCCAAGGTTGCCGTGCGTACCGCAATTGGTTTCGTTGTGATGGGATTCGTGGGTTTCTTCGTGAAGCTTATTTTCATTCCAATTAACAACATCATCGTCGGATCTGGTTAG

>Glyma14g05800.3   sequence type=predicted peptide   gene model=Glyma14g05800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDAIDSVFDPLREFAKDSVRLVKRCHKPDRKEFSKVAVRTAIGFVVMGFVGFFVKLIFIPINNIIVGSG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo