SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g05570): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g05570): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g05570

Feature Type:gene_model
Chromosome:Gm14
Start:3992937
stop:3998935
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G04550AT Annotation by Michelle Graham. TAIR10: indole-3-butyric acid response 5 | chr2:1588538-1589838 FORWARD LENGTH=257 SoyBaseE_val: 6.00E-114ISS
GO:0006470GO-bp Annotation by Michelle Graham. GO Biological Process: protein dephosphorylation SoyBaseN/AISS
GO:0006661GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0016311GO-bp Annotation by Michelle Graham. GO Biological Process: dephosphorylation SoyBaseN/AISS
GO:0043407GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of MAP kinase activity SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004725GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine phosphatase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008138GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine/serine/threonine phosphatase activity SoyBaseN/AISS
GO:0016791GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatase activity SoyBaseN/AISS
GO:0033549GO-mf Annotation by Michelle Graham. GO Molecular Function: MAP kinase phosphatase activity SoyBaseN/AISS
PTHR10159Panther DUAL SPECIFICITY PROTEIN PHOSPHATASE JGI ISS
PTHR10159:SF19Panther gb def: map kinase-specific phosphatase [drosophila melanogaster] JGI ISS
PF00782PFAM Dual specificity phosphatase, catalytic domain JGI ISS
UniRef100_G7K7F8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein-tyrosine-phosphatase IBR5 n=1 Tax=Medicago truncatula RepID=G7K7F8_MEDTR SoyBaseE_val: 2.00E-155ISS
UniRef100_I1M7K1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M7K1_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g05570 not represented in the dataset

Glyma14g05570 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g43410 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g051200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g05570.1   sequence type=CDS   gene model=Glyma14g05570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGAAAAGGGAGAGGGAGAATCCTTGTGGCGTGTGTGGCCACTATCACAAATATGAAGAAGGGGAAGTGTGTTCGATTTGCGGTCACCGGATTCCGGTTGGATCGGAGAAAACTTCGATACAAGTTAGTGCTTTTCCTTCCGTTGTTCTGCCGGAATTTCTTTACCTAGGAAGCTACGACAACGCATCACGCTCGGAGCTTCTGAAGACTCAGGGGATTTCTCGTATCCTCAATACCGTCCCTTCTTGTCAAAATCTCTACAAGAACTCGTTTACCTATCACTGCCTCCCAGATGACAAAACTTTGCCATTTGATGAAGCAATTCAGTTTCTTGAGCAATGTGAGAAGGATAAGGAGCGTGTTCTGGTTCATTGCATGTCAGGAAAGAGTAGGTCTCCAGCTATTGTGATTGCATACTTGATGAAGTCCAAAGGATGGAGACTTGTACACAGTTATCAGTGGGTAAAGGAACGGAGACCTTCTGTTGAATTAACTCAAGGTGTGTACCAGCAGCTGCAGGAGTTTGAGGAAAAGATCTATGGACGGATCGATAGTGGAAGCTCTCTGGTGCCTGGTTTCTTGCCTGCAGCACCTCCTTCAATTAGCTTTGGTTTTCCAAAGATCAATGATCCAGCTCAACTTCCCTCATTCAGCGCTGGAACTCCTTCAATCTTCGCGCGAGCACCTCTAGACATTGCTCCTACCGAGTTTACATTTGGTGCAGGTCAGACTCAGAAGAATGTGGCTGGAAATCCCTTTAATGCAAATCCAGCAAATCCAAATGGCACTGATATCCAAATGGATGGTTCTTGA

>Glyma14g05570.1   sequence type=predicted peptide   gene model=Glyma14g05570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRKRERENPCGVCGHYHKYEEGEVCSICGHRIPVGSEKTSIQVSAFPSVVLPEFLYLGSYDNASRSELLKTQGISRILNTVPSCQNLYKNSFTYHCLPDDKTLPFDEAIQFLEQCEKDKERVLVHCMSGKSRSPAIVIAYLMKSKGWRLVHSYQWVKERRPSVELTQGVYQQLQEFEEKIYGRIDSGSSLVPGFLPAAPPSISFGFPKINDPAQLPSFSAGTPSIFARAPLDIAPTEFTFGAGQTQKNVAGNPFNANPANPNGTDIQMDGS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo