SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g04721): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g04721): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g04721

Feature Type:gene_model
Chromosome:Gm14
Start:3258292
stop:3264315
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G42250AT Annotation by Michelle Graham. TAIR10: Zinc-binding alcohol dehydrogenase family protein | chr5:16894087-16897450 FORWARD LENGTH=390 SoyBaseE_val: 7.00E-30ISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
PTHR11695Panther ALCOHOL DEHYDROGENASE RELATED JGI ISS
PTHR11695:SF308Panther ALCOHOL DEHYDROGENASE 4 JGI ISS
PF08240PFAM Alcohol dehydrogenase GroES-like domain JGI ISS
UniRef100_G7K2X3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Alcohol dehydrogenase-like protein n=1 Tax=Medicago truncatula RepID=G7K2X3_MEDTR SoyBaseE_val: 4.00E-34ISS
UniRef100_UPI000233BE3BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BE3B related cluster n=1 Tax=unknown RepID=UPI000233BE3B SoyBaseE_val: 4.00E-48ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g04721 not represented in the dataset

Glyma14g04721 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g042800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g04721.1   sequence type=CDS   gene model=Glyma14g04721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGATAAACTAGCAACAACTAGTGAAGGACAACCCATAAGATGTAAAGCTGCGATTTGTCGCAAGCCAGGTTCTCCATTGAGTATTGAGGAGATCATTGTGGCACCACCAATGCCTCATGAAGCTCGGATTCGTGTTATATGCACTTCTCTTTGTCACAGCGATGTTACTTTTCGGAAAATGGAGGTCCCTCCTGCAATTTGTCCAAGAATTTTGGGTCATGAGGCTGTTGGGCTCAAGTTTGAAACGGAACTAGCTCAAAAGAAAGTTAAAAAGCAATGA

>Glyma14g04721.1   sequence type=predicted peptide   gene model=Glyma14g04721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEDKLATTSEGQPIRCKAAICRKPGSPLSIEEIIVAPPMPHEARIRVICTSLCHSDVTFRKMEVPPAICPRILGHEAVGLKFETELAQKKVKKQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo