SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma14g04180

Feature Type:gene_model
Chromosome:Gm14
Start:2808218
stop:2811424
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G44060AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant protein, group 2 | chr2:18226922-18227988 FORWARD LENGTH=325 SoyBaseE_val: 4.00E-164ISS
GO:0000902GO-bp Annotation by Michelle Graham. GO Biological Process: cell morphogenesis SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009269GO-bp Annotation by Michelle Graham. GO Biological Process: response to desiccation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03168PFAM Late embryogenesis abundant protein JGI ISS
UniRef100_C6TLT7UniRef Annotation by Michelle Graham. Best UniRef hit: Late-embryogenesis abundant protein 1 n=1 Tax=Glycine max RepID=C6TLT7_SOYBN SoyBaseE_val: 0ISS
UniRef100_C6TLT7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Late-embryogenesis abundant protein 1 n=1 Tax=Glycine max RepID=C6TLT7_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g44540 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g037300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g04180.1   sequence type=CDS   gene model=Glyma14g04180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGACATCTGATAAGCCAGAAGTGGTGGAAAGGGGTAGCAAGGATGAAAAACACAAGGAAGATGATCAAGAGGAGGGGAAGGGTGGATTCATTGAGAAGGTGAAGGATTTCATTCATGACATTGGTGAGAAGATTGAGGAAGCTATTGGGTTTGGGAAGCCAACTGCTGACGTTACTGCGATTCACATTCCATCGATTAATCTTCACAAGGCAGATCTTGTTGTTGATGTGCTCATCAAGAACCCGAATCCGGTGCCAATCCCTCTGATTGACATAGATTACTTGGTTGACAGTGATGAAAGGAAGCTAGTTTCTGGATTGATACCAGATGCGGGTACCATCGGTGCACATGGAGAGCAGACTGTCAAAATTCCTGTCACTTTGATTTATGATGACATCAAGCAAACATATGCTGATATTAAACCTGGAAGCATCATTCCTTATAGGGTGAAGGTTAGTCTCATTTTTGATGTTCCCATCTTGGGAAGGCTAACTCTACCTTTGGAGAAAACTGGAGAAATCCCCATACCATACAAGCCTGATATTGATCTTGAGAAGATTCATTTTGAAAGGTTCTCTTTTGAAGAGACAATTGCAACGCTTCATTTGAAGTTGGAAAACAAGAATGATTTCGACCTTGGCCTCAATGCGCTCGATTATGAGGTCTGGCTTGGTGATGTTAGCATTGGTGGTGCAGAACTCACCAAGTCTGCTAAAATTGAGAAAAGTGGAATTAGTTATATTGATATTCCAATTACCTTCAGGCCCAAGGATTTTGGCTCTGCACTCTGGGACATGATTAGAGGAAGGGGAACAGGTTACACCATGAAAGGACATATTGATGTTGACACTCCCTTTGGAGCAATGAAGTTGCCCATCAGCAAAGAAGGTGGTACTACCCGTCTTAAGAAAAAGAAGGAAGATCGTGATTATGATGACGATGACGATGATGAGGATTGA

>Glyma14g04180.1   sequence type=predicted peptide   gene model=Glyma14g04180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTSDKPEVVERGSKDEKHKEDDQEEGKGGFIEKVKDFIHDIGEKIEEAIGFGKPTADVTAIHIPSINLHKADLVVDVLIKNPNPVPIPLIDIDYLVDSDERKLVSGLIPDAGTIGAHGEQTVKIPVTLIYDDIKQTYADIKPGSIIPYRVKVSLIFDVPILGRLTLPLEKTGEIPIPYKPDIDLEKIHFERFSFEETIATLHLKLENKNDFDLGLNALDYEVWLGDVSIGGAELTKSAKIEKSGISYIDIPITFRPKDFGSALWDMIRGRGTGYTMKGHIDVDTPFGAMKLPISKEGGTTRLKKKKEDRDYDDDDDDED*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo