SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g03470

Feature Type:gene_model
Chromosome:Gm14
Start:2247394
stop:2249143
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g03470
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G30860AT Annotation by Michelle Graham. TAIR10: glutathione S-transferase PHI 9 | chr2:13139132-13140057 FORWARD LENGTH=215 SoyBaseE_val: 2.00E-98ISS
GO:0006546GO-bp Annotation by Michelle Graham. GO Biological Process: glycine catabolic process SoyBaseN/AISS
GO:0006569GO-bp Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009684GO-bp Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process SoyBaseN/AISS
GO:0010043GO-bp Annotation by Michelle Graham. GO Biological Process: response to zinc ion SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004364GO-mf Annotation by Michelle Graham. GO Molecular Function: glutathione transferase activity SoyBaseN/AISS
GO:0004602GO-mf Annotation by Michelle Graham. GO Molecular Function: glutathione peroxidase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0043295GO-mf Annotation by Michelle Graham. GO Molecular Function: glutathione binding SoyBaseN/AISS
KOG0867 KOG Glutathione S-transferase JGI ISS
PTHR11260Panther GLUTATHIONE S-TRANSFERASE, GST, SUPERFAMILY, GST DOMAIN CONTAINING JGI ISS
PTHR11260:SF55Panther SUBFAMILY NOT NAMED JGI ISS
PF00043PFAM Glutathione S-transferase, C-terminal domain JGI ISS
PF02798PFAM Glutathione S-transferase, N-terminal domain JGI ISS
UniRef100_Q9FQD4UniRef Annotation by Michelle Graham. Best UniRef hit: Glutathione S-transferase GST 24 n=1 Tax=Glycine max RepID=Q9FQD4_SOYBN SoyBaseE_val: 2.00E-156ISS
UniRef100_Q9FQD4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutathione S-transferase GST 24 n=1 Tax=Glycine max RepID=Q9FQD4_SOYBN SoyBaseE_val: 2.00E-156ISS

Expression Patterns of Glyma14g03470
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g03470
ParalogEvidenceComments
Glyma02g45336 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g03470 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g031000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g03470
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g03470
>Glyma14g03470.1   sequence type=CDS   gene model=Glyma14g03470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTGAAAGTATACGGTCCCCACTGTGCTTCCACCAAGCGGGTGCTGGTTTGTCTGGTTGAGAAGGAAGTCGAATTTGAGGTTGTCCCTGTTGATGTCACTAAGGGGGAGCAGAAGGATCCTGAGTACCTCAAACTACAGCCATTTGGAGTTGTTCCTGTCATCAAAGATGGAGATTATACCTTATATGAATCTCGTGCTATAATGAGGTATTATGCAGAAAAATACAGATCTCAAGGGGTTGAGTTGCTGGGAAAAACAATAGAAGAGAGGGGTCTAGTGGAGCAATGGCTAGAAGTTGAAGCACACAACTTTCATCCACAAGCCTACAACTTGTGTCTTCATGGTTTGTTTGGTTCACTATTTGGTGTGACTCCAGATCCCAAGGTGATTGAGGAGAGTGAAGCAAAGCTGGTACAAGTGTTGAACATCTATGAGGAGAGGCTCTCAAAGACTAAGTATTTGGCTGGGGATTTCTTCAGCATTGCTGATATTAGCCACCTTCCATTTCTTGATTATGTTGTGAACAATATGGGGAAAAAGTATTTGTTAGAGGAGAGGAAGCATGTGGGTGCCTGGTGGGATGACATTAGCAGTAGACCATCATGGAACAAGGTTCTCCAGCTCTACAGAGCTCCAATCTAG
Predicted protein sequences of Glyma14g03470
>Glyma14g03470.1   sequence type=predicted peptide   gene model=Glyma14g03470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVKVYGPHCASTKRVLVCLVEKEVEFEVVPVDVTKGEQKDPEYLKLQPFGVVPVIKDGDYTLYESRAIMRYYAEKYRSQGVELLGKTIEERGLVEQWLEVEAHNFHPQAYNLCLHGLFGSLFGVTPDPKVIEESEAKLVQVLNIYEERLSKTKYLAGDFFSIADISHLPFLDYVVNNMGKKYLLEERKHVGAWWDDISSRPSWNKVLQLYRAPI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo