|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G50740 | AT | Annotation by Michelle Graham. TAIR10: Transmembrane proteins 14C | chr1:18807861-18808765 FORWARD LENGTH=119 | SoyBase | E_val: 7.00E-58 | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0009963 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process | SoyBase | N/A | ISS |
| GO:0010200 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to chitin | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0030968 | GO-bp | Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response | SoyBase | N/A | ISS |
| GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| KOG4267 | KOG | Predicted membrane protein | JGI | ISS | |
| PTHR12668 | Panther | TRANSMEMBRANE PROTEIN 14, 15 | JGI | ISS | |
| PF03647 | PFAM | Transmembrane proteins 14C | JGI | ISS | |
| UniRef100_B9SAE9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Transmembrane protein 14, putative n=1 Tax=Ricinus communis RepID=B9SAE9_RICCO | SoyBase | E_val: 5.00E-46 | ISS |
| UniRef100_I1M6T8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M6T8_SOYBN | SoyBase | E_val: 6.00E-78 | ISS |
|
Glyma14g02810 not represented in the dataset |
Glyma14g02810 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.14g024900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g02810.1 sequence type=CDS gene model=Glyma14g02810 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCACGATTTCTGCTTCACGATCCCCTACGGATTGATGTTAGTGGGTGGTGGACTGTTCGCCTACATAAGCAAAGGGAGCATCGCTTCTCTCGCCGGAGGCGCCGGCTCCGGTTTGCTTCTCATCGTCGCCGGCTATCTCAGTCTCAATGCTTTCGGCAAACGAAAAAACTCTTACCTCGCTCTCTTTCTCGAGACCGTTTGTGCAGCCATACTAACTTGGGTCATGGGGCAGCGATATTTGGAAACATCCAAGATTATGCCTGCTGGTCTTGTTGCTGGAATCAGTGCTCTCATGACTCTGTTTTATCTCTACAAATTAGCAACTGGTGGCAACCATCTCCCCACCAAGGCTGAGTGA
>Glyma14g02810.1 sequence type=predicted peptide gene model=Glyma14g02810 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MHDFCFTIPYGLMLVGGGLFAYISKGSIASLAGGAGSGLLLIVAGYLSLNAFGKRKNSYLALFLETVCAAILTWVMGQRYLETSKIMPAGLVAGISALMTLFYLYKLATGGNHLPTKAE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||