SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g01970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g01970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g01970

Feature Type:gene_model
Chromosome:Gm14
Start:1148816
stop:1150115
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54630AT Annotation by Michelle Graham. TAIR10: zinc finger protein-related | chr5:22192607-22194260 REVERSE LENGTH=472 SoyBaseE_val: 3.00E-28ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006417GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of translation SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
UniRef100_B9SST1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nucleic acid binding protein, putative n=1 Tax=Ricinus communis RepID=B9SST1_RICCO SoyBaseE_val: 2.00E-53ISS
UniRef100_I1M6J2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M6J2_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g01970 not represented in the dataset

Glyma14g01970 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g016100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g01970.1   sequence type=CDS   gene model=Glyma14g01970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATGCCATGTGGGTCTCCTTGAAGGATAATGTCAAATGTGGAAACAAGCTCAACGATGTAATCAAGCAGCAAACAAAATGCGGCAAAGGAAGTGGCTATGTTGCAGAAAAGGAGAAAATGAATGGATATAATAGACCTCTAATGGAAACTCCAACTAGCCTAGTGGTTTCAAGACCAAGCAACACACTGGGAAGGCTTCATGAGCTGAGTGTTGGAGACCCATCAAGAAAAATTGTGGAGATGATATTTCAAAAAGCTTGGTTTAACAAATCAAAGCCAGTGAAGAAGGTCAGAACAGTCCTCAGGGTGAGTTACTCAGAAGAAGTCCTTGAAAGGTTTGAGAAGTATAGAGAATATGTCAAGAAGGTGGCCTCTGAGCAAAATCCAAGGAATCCAAGGAGCGCAGTTGATGGGAACGAACTGTTGCAGTTCTATGGTACTACAATGAGATGTTTTCAAGGAAAATCTGCTAAGAAAGTTCATGATCTGTGTAAAGATCCATCTTGTTATCTTTGTCAAATAATTCAGTTTAATTTCAACACACGATATGCCGAGATTCACTTGAATACAAGTGACAAAGAGTCGAGAAACAGAACAACTGCCACTGCCAGAGTACATAATGTGAAAAAAGCTGCAATAATTTGCAGGATAATTGCTGGAACTGCAGTAAATGAAGTTGATGGTGAATATGAAGGGTCTCACTCAACTGGGTTGGGAGAAATGCAGTTTACCTTACAAAAATTTGTAGTAAAAAATCCCAGTTCTATTCTTCCTTGTTTTGTAATAATTTTCAGCTAA

>Glyma14g01970.1   sequence type=predicted peptide   gene model=Glyma14g01970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHAMWVSLKDNVKCGNKLNDVIKQQTKCGKGSGYVAEKEKMNGYNRPLMETPTSLVVSRPSNTLGRLHELSVGDPSRKIVEMIFQKAWFNKSKPVKKVRTVLRVSYSEEVLERFEKYREYVKKVASEQNPRNPRSAVDGNELLQFYGTTMRCFQGKSAKKVHDLCKDPSCYLCQIIQFNFNTRYAEIHLNTSDKESRNRTTATARVHNVKKAAIICRIIAGTAVNEVDGEYEGSHSTGLGEMQFTLQKFVVKNPSSILPCFVIIFS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo