Glyma14g01260 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g01260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g01260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g01260

Feature Type:	gene_model
Chromosome:	Gm14
Start:	680666
stop:	681130
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g01260

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G48170	AT	Annotation by Michelle Graham. TAIR10: F-box family protein \| chr5:19532729-19533202 REVERSE LENGTH=157	SoyBase	E_val: 2.00E-47	ISS
GO:0009740	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009937	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0048831	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of shoot development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0019005	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: SCF ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR22844	Panther	F-BOX AND WD40 DOMAIN PROTEIN	JGI		ISS
PTHR22844:SF68	Panther	OS03G0196500 PROTEIN	JGI		ISS
PF00646	PFAM	F-box domain	JGI		ISS
UniRef100_G7KEM1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: F-box protein SNE n=1 Tax=Medicago truncatula RepID=G7KEM1_MEDTR	SoyBase	E_val: 6.00E-85	ISS
UniRef100_I1M6B2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M6B2_SOYBN	SoyBase	E_val: 4.00E-108	ISS

Expression Patterns of Glyma14g01260

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g01260 not represented in the dataset	Glyma14g01260 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g01260

Paralog	Evidence	Comments
Glyma02g47500	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g01260 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g009000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g01260

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g01260

Limit To All Plant Sequences

>Glyma14g01260.1   sequence type=CDS   gene model=Glyma14g01260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGCAGCAGCAGCAGCACCGCAGAGAGCAAGAGAAACGACCTCGGTTCTTCATAAACGACAACATTGACATTCTCCGGGAAATCCTTAAACGCCTCGACGGTCCCTCGCTGGGCGTGGCGGCGTGCGTGTGTCGGCTGTGGTGCAGCCTCACGCGCAACGACGACTCGCTGTGGGAGCACCTGTGCTTCCGCCACGTGTCGTCACCGCCGACGGCGTCGGTGAGGGCGGTGGTGGTGGCGCTGGGCGGGTACAAGCGGCTGTACATGGTGTGCGTGAGACCGGTGCTGAGTCGACTCGGAAACTCGGAGCGGGTGAGGAAGCGAGTGTGGACTCGGCACGAGGTGCAGCTCTCGCTCTCCTTGTTTTGCATTGACAGCTACGAGAGGCTCGAGAGTGGAAGGATCCCCAGCGACGCGTCCGCATCGTCCCTCATGTTCCTCTGCAACACTGTCAACGTCTGA

Predicted protein sequences of Glyma14g01260

Limit To All Plant Sequences

>Glyma14g01260.1   sequence type=predicted peptide   gene model=Glyma14g01260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVQQQQHRREQEKRPRFFINDNIDILREILKRLDGPSLGVAACVCRLWCSLTRNDDSLWEHLCFRHVSSPPTASVRAVVVALGGYKRLYMVCVRPVLSRLGNSERVRKRVWTRHEVQLSLSLFCIDSYERLESGRIPSDASASSLMFLCNTVNV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain