SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g00790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g00790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g00790

Feature Type:gene_model
Chromosome:Gm14
Start:398161
stop:401205
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07680AT Annotation by Michelle Graham. TAIR10: emp24/gp25L/p24 family/GOLD family protein | chr3:2455627-2456652 FORWARD LENGTH=208 SoyBaseE_val: 1.00E-115ISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005789GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0030134GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ER to Golgi transport vesicle SoyBaseN/AISS
GO:0008320GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transmembrane transporter activity SoyBaseN/AISS
KOG1692 KOG Putative cargo transport protein EMP24 (p24 protein family) JGI ISS
PTHR22811Panther COPII-COATED VESICLE MEMBRANE PROTEIN JGI ISS
PTHR22811:SF8Panther COATED VESICLE MEMBRANE PROTEIN JGI ISS
PF01105PFAM emp24/gp25L/p24 family/GOLD JGI ISS
UniRef100_G7K0K7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transmembrane emp24 domain-containing protein n=2 Tax=Medicago truncatula RepID=G7K0K7_MEDTR SoyBaseE_val: 3.00E-136ISS
UniRef100_I1M672UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M672_SOYBN SoyBaseE_val: 1.00E-154ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g00790 not represented in the dataset

Glyma14g00790 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g47820 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g004900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g00790.1   sequence type=CDS   gene model=Glyma14g00790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGTTATCATTGAGGCATGCTTTGGTGTTTGCGTTAATTGGGGCGTTGTGGAACTTGCAGAGGGCAGAGGGTATCCGATTTGTGATAGACAGAGACGAGTGTTTCTCCCATGACGTAAAGTACGAGGGTGACACTGTTCATGTCTCTTTCGTTGTTATTAAGGCTGATTCTCCCTGGCATTACGGCGACGAAGGTGTCGATCTCGTGGTAAAGGGACCTTCTGGCGAGCAAATACAAGATTTTCGGGACAAGACCAGTGAGAAGTTCGATTTTGTGGCTCACAAATCCGGGGTCCATAAATTCTGCTTCACCAACAAGTCTCCTTATCATGAAACTGTTGATTTTGATGTACATGTTGGTCACTTCTCTTACTTTGAGCAACATGCAAAAGATGAGCATTTCACCCCTTTGCTGGAGCAGATTGGGAAGTTGGAGGAAGCTCTATACAACATTCAGTTTGAACAGCATTGGTTAGAGGCTCAGACTGACCGCCAAGCAATAGTGAACGATGCAATGAGCAGAAGAGCAGTACACAAGGCAATTTTTGAATCAGCAGCACTGATTGGGGCTAGTGCGCTGCAAGTCTACCTTCTGCAGCGATTGTTTGAACGAAAGTTGGGTACCTCGAGAGTTTAG

>Glyma14g00790.1   sequence type=predicted peptide   gene model=Glyma14g00790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRLSLRHALVFALIGALWNLQRAEGIRFVIDRDECFSHDVKYEGDTVHVSFVVIKADSPWHYGDEGVDLVVKGPSGEQIQDFRDKTSEKFDFVAHKSGVHKFCFTNKSPYHETVDFDVHVGHFSYFEQHAKDEHFTPLLEQIGKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAVHKAIFESAALIGASALQVYLLQRLFERKLGTSRV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo