SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g44681

Feature Type:gene_model
Chromosome:Gm13
Start:44065613
stop:44066298
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g44681
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80760AT Annotation by Michelle Graham. TAIR10: NOD26-like intrinsic protein 6;1 | chr1:30350640-30352015 REVERSE LENGTH=305 SoyBaseE_val: 1.00E-67ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0010264GO-bp Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process SoyBaseN/AISS
GO:0046713GO-bp Annotation by Michelle Graham. GO Biological Process: borate transport SoyBaseN/AISS
GO:0080029GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to boron-containing substance levels SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0015168GO-mf Annotation by Michelle Graham. GO Molecular Function: glycerol transmembrane transporter activity SoyBaseN/AISS
GO:0015204GO-mf Annotation by Michelle Graham. GO Molecular Function: urea transmembrane transporter activity SoyBaseN/AISS
GO:0015250GO-mf Annotation by Michelle Graham. GO Molecular Function: water channel activity SoyBaseN/AISS
GO:0046715GO-mf Annotation by Michelle Graham. GO Molecular Function: borate transmembrane transporter activity SoyBaseN/AISS
PTHR19139Panther AQUAPORIN TRANSPORTER JGI ISS
PTHR19139:SF22Panther gb def: glycerol uptake facilitator protein [mycoplasma pulmonis] JGI ISS
PF00230PFAM Major intrinsic protein JGI ISS
UniRef100_A9YTW7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Major intrinsic protein NIP6;1 n=2 Tax=Lotus japonicus RepID=A9YTW7_LOTJA SoyBaseE_val: 2.00E-73ISS
UniRef100_UPI000233B4EAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B4EA related cluster n=1 Tax=unknown RepID=UPI000233B4EA SoyBaseE_val: 2.00E-100ISS

Expression Patterns of Glyma13g44681
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g44681 not represented in the dataset
Glyma13g44681 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g44681
ParalogEvidenceComments
Glyma15g00620 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g44681 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma13g44681
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g44681
>Glyma13g44681.1   sequence type=CDS   gene model=Glyma13g44681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AATTGCAAGAAGTCCCTCCTGAAGAGTTGTAGGTGTTTCAGTGTGGAGGAATGGAGCTTAGAAGATGGAGGTTTACCGGCGGTGTCATGCTCATTGGCACTGCCACCTCCTCCACCAGGGGTCCCTCTTGCAAGAAAGGTTGGAGCTGAGTTCATAGGGACCTTCATTCTCATGTTCACAGGCACTGCCGCTGCCATTGTCAACCAAAAGACAAATGGCTCTGAGACCCTTATTGGATGTGCTGCCACCACTGGCCTCGCCGTCATGATTCACTTCCCTTGGAAGCATGTGCCCATGTATATTGGTGCACAAGTTTTGGCATCTAAATATATATGCGCCGGATTTGCTCTCAAGGGGGTTTATCACCCTTTCATGCGTGGTGGAGTCACCGTTCCTTCCGGAGGATATGGCCAAGCTTTTGCTTTGGAGTTCATTATTGCCTTCAACCTCATGTTCGTTGCCACCGACACCAGAGCTGTCAGACTTGGGTTTTTGGAGGAGATACAAAAAACAGTGATACTTTTCAGGCATTCATATAACCTTTTGGAGAATCCTATGTCACATTTTTTTTAA
Predicted protein sequences of Glyma13g44681
>Glyma13g44681.1   sequence type=predicted peptide   gene model=Glyma13g44681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NCKKSLLKSCRCFSVEEWSLEDGGLPAVSCSLALPPPPPGVPLARKVGAEFIGTFILMFTGTAAAIVNQKTNGSETLIGCAATTGLAVMIHFPWKHVPMYIGAQVLASKYICAGFALKGVYHPFMRGGVTVPSGGYGQAFALEFIIAFNLMFVATDTRAVRLGFLEEIQKTVILFRHSYNLLENPMSHFF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo