SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g44607): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g44607): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g44607

Feature Type:gene_model
Chromosome:Gm13
Start:43987322
stop:43987997
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g44607
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G63200AT Annotation by Michelle Graham. TAIR10: PATATIN-like protein 9 | chr3:23346140-23347379 FORWARD LENGTH=384 SoyBaseE_val: 2.00E-34ISS
GO:0006629GO-bp Annotation by Michelle Graham. GO Biological Process: lipid metabolic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0045735GO-mf Annotation by Michelle Graham. GO Molecular Function: nutrient reservoir activity SoyBaseN/AISS
PTHR10470Panther PATATIN-RELATED JGI ISS
UniRef100_G1FMF2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Patatin-like phospholipase (Fragment) n=1 Tax=Populus tremula RepID=G1FMF2_POPTN SoyBaseE_val: 2.00E-35ISS
UniRef100_UPI000233B4E5UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B4E5 related cluster n=1 Tax=unknown RepID=UPI000233B4E5 SoyBaseE_val: 8.00E-99ISS

Expression Patterns of Glyma13g44607
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g44607 not represented in the dataset
Glyma13g44607 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g44607 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g368800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g44607
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g44607
>Glyma13g44607.1   sequence type=CDS   gene model=Glyma13g44607   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACAATCCAGCAGTAGCTGTCGTCACGCACGTCCTCCACAACAAGTGCGATTTCCCGTCGGTGAACGGCATGGAGGATCTCCTCGTCCTGTCCATCGGAAACAGAGCTCAAGCAAAGAGAATGAACAACGCCGGTGAGTGCTCGACGTCGACAGTGGTTGACATTGCGCTCGACGGCGTTTTCGAGACCACTGACCAGATGCTAGGAAATGCCTTCTGTTGGAACCGTACGGACTATGTCAGGATTCAAGACGAGGAGATCTTGCACGCCGTTCATCGATGGGAAATCGTGCTTCTTGTGGAGGACGTGCGTGACGGCAGCTGCTGTCAGATTGTTCATCACCAGGCCATCGTCGACGGAGGAGAAGTGGAAGGGAGTGAAGAGGCCAGGGGTCGCCGACGGTGCGAGGTGCGGTCCTCGCAACAATAA
Predicted protein sequences of Glyma13g44607
>Glyma13g44607.1   sequence type=predicted peptide   gene model=Glyma13g44607   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNNPAVAVVTHVLHNKCDFPSVNGMEDLLVLSIGNRAQAKRMNNAGECSTSTVVDIALDGVFETTDQMLGNAFCWNRTDYVRIQDEEILHAVHRWEIVLLVEDVRDGSCCQIVHHQAIVDGGEVEGSEEARGRRRCEVRSSQQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo