Glyma13g44180 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g44180

Feature Type:	gene_model
Chromosome:	Gm13
Start:	43694505
stop:	43695841
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g44180

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G15760	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 10 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G52565.1); Has 42 Blast hits to 42 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 42; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr3:5337734-5338219 FORWARD LENGTH=135	SoyBase	E_val: 7.00E-17	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009646	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to absence of light	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1M5T4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M5T4_SOYBN	SoyBase	E_val: 8.00E-77	ISS

Expression Patterns of Glyma13g44180

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g44180

Paralog	Evidence	Comments
Glyma15g01100	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g44180 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g365000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g44180

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g44180

Limit To All Plant Sequences

>Glyma13g44180.1   sequence type=CDS   gene model=Glyma13g44180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTATCTCACAGGGCCTTGTTCTCACCAGTGCCATGCTTCTCTCAACAACTCTGCTTTATGTTGCTTTCTCCAGGCAAAAAACCACCCCATCATTTCAAATTCATCACTCTAACAAACCCACCTTGCGATCTTGCTTGTATTCAGAGGAAAAGAAAAGGGAGAGAAAGAAGAAGAAAGTGAAATTTGCAGATAGTGTGAAGGAGGGAAGAGAAAGGAATGAGCAAAGAAGCAACAGCAGACAAAGTGGTGGAATGCCAATGCCAGCAAACAGAATGGCTTTGTATTACGGGATTTTGAGGAACCGAGTGCATAGAATTGAGTGCTCTCACTAA

Predicted protein sequences of Glyma13g44180

Limit To All Plant Sequences

>Glyma13g44180.1   sequence type=predicted peptide   gene model=Glyma13g44180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASISQGLVLTSAMLLSTTLLYVAFSRQKTTPSFQIHHSNKPTLRSCLYSEEKKRERKKKKVKFADSVKEGRERNEQRSNSRQSGGMPMPANRMALYYGILRNRVHRIECSH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain