Report for Sequence Feature Glyma13g44080
Feature Type: gene_model
Chromosome: Gm13
Start: 43624187
stop: 43625314
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g44080
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G80180 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 10 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G15400.3); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr1:30157057-30157473 REVER
SoyBase E_val: 7.00E-28 ISS
GO:0010375 GO-bp
Annotation by Michelle Graham. GO Biological Process: stomatal complex patterning
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1M5S4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M5S4_SOYBN
SoyBase E_val: 7.00E-79 ISS
Expression Patterns of Glyma13g44080
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma13g44080
Paralog Evidence Comments
Glyma15g01260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g44080 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g364000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g44080
Coding sequences of Glyma13g44080
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g44080.2 sequence type=CDS gene model=Glyma13g44080 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTGGTCTTCAAAGATCTGCAGTGTCCTTCAGGAGGCAGGGTTCATCAGGCTTCGTTTGGGACGATAGGTTCTTATCAGAGGAATTGAACAAAGTCAAAGAAGATCAGAACAACAACAACGATGGCGGCCCCGAGATTAAAGAGCTTCATCAAGTTCAAACAACGCCGCCACCGGAGAGAACCCGCTCCAACGGCGGAGCACGGGGTTACCGCACCGGAAAAGTTTCGCCGGCAATTGAGCCACCGTCTCCCAGGCTCTCTGCATGCGGCTTCTGCGCCGCCTTTGGGAAAGCAGGGGACAACAAGCCCCAACGGACTACACCCGCCAAACATCGACCAAGGTAG
Predicted protein sequences of Glyma13g44080
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g44080.2 sequence type=predicted peptide gene model=Glyma13g44080 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAGLQRSAVSFRRQGSSGFVWDDRFLSEELNKVKEDQNNNNDGGPEIKELHQVQTTPPPERTRSNGGARGYRTGKVSPAIEPPSPRLSACGFCAAFGKAGDNKPQRTTPAKHRPR*