SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g44080

Feature Type:gene_model
Chromosome:Gm13
Start:43624187
stop:43625314
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g44080
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80180AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 10 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G15400.3); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr1:30157057-30157473 REVER SoyBaseE_val: 7.00E-28ISS
GO:0010375GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal complex patterning SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1M5S4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M5S4_SOYBN SoyBaseE_val: 7.00E-79ISS

Expression Patterns of Glyma13g44080
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g44080
ParalogEvidenceComments
Glyma15g01260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g44080 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g364000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g44080
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g44080
>Glyma13g44080.2   sequence type=CDS   gene model=Glyma13g44080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGGTCTTCAAAGATCTGCAGTGTCCTTCAGGAGGCAGGGTTCATCAGGCTTCGTTTGGGACGATAGGTTCTTATCAGAGGAATTGAACAAAGTCAAAGAAGATCAGAACAACAACAACGATGGCGGCCCCGAGATTAAAGAGCTTCATCAAGTTCAAACAACGCCGCCACCGGAGAGAACCCGCTCCAACGGCGGAGCACGGGGTTACCGCACCGGAAAAGTTTCGCCGGCAATTGAGCCACCGTCTCCCAGGCTCTCTGCATGCGGCTTCTGCGCCGCCTTTGGGAAAGCAGGGGACAACAAGCCCCAACGGACTACACCCGCCAAACATCGACCAAGGTAG
Predicted protein sequences of Glyma13g44080
>Glyma13g44080.2   sequence type=predicted peptide   gene model=Glyma13g44080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGLQRSAVSFRRQGSSGFVWDDRFLSEELNKVKEDQNNNNDGGPEIKELHQVQTTPPPERTRSNGGARGYRTGKVSPAIEPPSPRLSACGFCAAFGKAGDNKPQRTTPAKHRPR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo