SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g44060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g44060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g44060

Feature Type:gene_model
Chromosome:Gm13
Start:43610849
stop:43612152
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g44060
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G62200AT Annotation by Michelle Graham. TAIR10: Embryo-specific protein 3, (ATS3) | chr5:24984463-24985674 REVERSE LENGTH=190 SoyBaseE_val: 4.00E-26ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF06232PFAM Embryo-specific protein 3, (ATS3) JGI ISS
UniRef100_I1M5S2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M5S2_SOYBN SoyBaseE_val: 6.00E-81ISS
UniRef100_Q2HUA9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Embryo-specific 3 n=1 Tax=Medicago truncatula RepID=Q2HUA9_MEDTR SoyBaseE_val: 1.00E-30ISS

Expression Patterns of Glyma13g44060
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g44060 not represented in the dataset
Glyma13g44060 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g44060 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g363800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g44060
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g44060
>Glyma13g44060.2   sequence type=CDS   gene model=Glyma13g44060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGCTCTGAATTTGACTTTAATCCTCACATTTTGCATCATTGCTGCCCTCTCACAAGCAACGCATCATCTAGCCATCAAATCTTCGAAGCTTAACCAAACCCAGCAGCAGCTCGACGAGGGTTGTAGTTACGTTGCCACCATAAAGACAAGTTGCAGTTCTACTTTCTACGCGAGAGGTGAAATCGATCTTATATTTGGTGACGCTTATGGCAATCAGGTTTATGTTCCAGAACTGCCTGGTCATTTTGATGATTGTTCTACGAATTCATATGATGTGATACAGCACGGTGCATGTACACACCAAATCTGCCATCTACAGCTATACTGGACTGGAGATTCTGATTTGATACTGGAGACAGTGAGCATATATAACCACCTCGACGACCCTGTTACATTTTACTACCACACTGTTATTCCTCCGGCGGGTGGTCCCTATGGCTTTGATGATTGTCATGATTATTAG
Predicted protein sequences of Glyma13g44060
>Glyma13g44060.2   sequence type=predicted peptide   gene model=Glyma13g44060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDALNLTLILTFCIIAALSQATHHLAIKSSKLNQTQQQLDEGCSYVATIKTSCSSTFYARGEIDLIFGDAYGNQVYVPELPGHFDDCSTNSYDVIQHGACTHQICHLQLYWTGDSDLILETVSIYNHLDDPVTFYYHTVIPPAGGPYGFDDCHDY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo