SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g43570): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g43570): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g43570

Feature Type:gene_model
Chromosome:Gm13
Start:43207406
stop:43210176
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G79900AT Annotation by Michelle Graham. TAIR10: Mitochondrial substrate carrier family protein | chr1:30052524-30053599 REVERSE LENGTH=296 SoyBaseE_val: 3.00E-142ISS
GO:0006561GO-bp Annotation by Michelle Graham. GO Biological Process: proline biosynthetic process SoyBaseN/AISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006839GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrial transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005743GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane SoyBaseN/AISS
GO:0000064GO-mf Annotation by Michelle Graham. GO Molecular Function: L-ornithine transmembrane transporter activity SoyBaseN/AISS
GO:0005290GO-mf Annotation by Michelle Graham. GO Molecular Function: L-histidine transmembrane transporter activity SoyBaseN/AISS
GO:0005476GO-mf Annotation by Michelle Graham. GO Molecular Function: carnitine:acyl carnitine antiporter activity SoyBaseN/AISS
GO:0015181GO-mf Annotation by Michelle Graham. GO Molecular Function: arginine transmembrane transporter activity SoyBaseN/AISS
GO:0015189GO-mf Annotation by Michelle Graham. GO Molecular Function: L-lysine transmembrane transporter activity SoyBaseN/AISS
KOG0762 KOG Mitochondrial carrier protein JGI ISS
PTHR24089Panther FAMILY NOT NAMED JGI ISS
PTHR24089:SF127Panther JGI ISS
PF00153PFAM Mitochondrial carrier protein JGI ISS
UniRef100_G7JJD6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial carnitine/acylcarnitine carrier protein n=1 Tax=Medicago truncatula RepID=G7JJD6_MEDTR SoyBaseE_val: 5.00E-163ISS
UniRef100_I1M5L0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M5L0_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g43570 not represented in the dataset

Glyma13g43570 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma15g01830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g358800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g43570.1   sequence type=CDS   gene model=Glyma13g43570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATTTTGGCCAGAATTTCTTGCTAGTAGTACGGGTAAAGAGTTTGTGGCTGGAGGATTTGGAGGCACTGCTGGTATAATCTCAGGTTACCCATTAGACACGCTCCGTGTGATGCAACAAAGCTCCAACAATGGCTCTGCTGCCTTCACCATCCTCAGAAATTTGGTGGCCAAGGAAGGACCAACTGCTCTGTACCGTGGCATGGCTGCACCTTTGGCCTCTGTTACATTTCAGAACGCTATGGTTTTCCAAATTTACGCAGTTCTCTCTAGGGCATTTAGCACGTCCGTTTCTGTCAACGACCCTCCTTCCTACAAGGGTGTTGCTTTAGGAGGATTTTGCTCTGGCGCTTTGCAGAGCATGCTGCTCTCCCCTGTTGAGTTAGTTAAAATTCGCCTTCAGCTTCAGAACACAGGACAATCCACAGAACCACAAAAGGGTCCCATAAAGGTCGCCAACAACATATGGAAAAGAGAGGGTCTTCGTGGCATTTATCGAGGACTTGGCATCACTATGCTAAGAGATGCACCTGCACATGGCCTCTACTTTTGGACATATGAATATGCGAGGGAGAAACTTCACCCAGGTTGTAGAAGAAGTTGTCAAGAGACCTTGAATACTATGTTGGTATCAGGAGGATTGGCTGGGGTTGTGAGTTGGGTTTTTAGCTACCCTTTGGACGTTATAAAGACAAGATTGCAGGCTCAGACACTTTCTTCGCGGAAATACAAAGGCATTTTGGATTGTCTTCGGAAGAGCGTTGAAGAGGAAGGATACGTTGTGCTATGGCGGGGTTTAGGAACTGCGGTTGCTAGAGCCTTTGTTGTGAATGGTGCTATATTTTCTGCTTATGAGATCACTCTTAGGTGTCTGTTTGACAAATAA

>Glyma13g43570.1   sequence type=predicted peptide   gene model=Glyma13g43570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEFWPEFLASSTGKEFVAGGFGGTAGIISGYPLDTLRVMQQSSNNGSAAFTILRNLVAKEGPTALYRGMAAPLASVTFQNAMVFQIYAVLSRAFSTSVSVNDPPSYKGVALGGFCSGALQSMLLSPVELVKIRLQLQNTGQSTEPQKGPIKVANNIWKREGLRGIYRGLGITMLRDAPAHGLYFWTYEYAREKLHPGCRRSCQETLNTMLVSGGLAGVVSWVFSYPLDVIKTRLQAQTLSSRKYKGILDCLRKSVEEEGYVVLWRGLGTAVARAFVVNGAIFSAYEITLRCLFDK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo