SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g43470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g43470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g43470

Feature Type:gene_model
Chromosome:Gm13
Start:43157830
stop:43158960
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16070AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G15260.1); Has 26 Blast hits to 26 proteins in 7 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:5451864-5452316 REVERSE LENGTH=150 SoyBaseE_val: 2.00E-20ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7JJE1UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP-dependent RNA helicase chl1 n=1 Tax=Medicago truncatula RepID=G7JJE1_MEDTR SoyBaseE_val: 2.00E-54ISS
UniRef100_I1M5K5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1M5K5_SOYBN SoyBaseE_val: 2.00E-156ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g43470 not represented in the dataset

Glyma13g43470 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma15g01850 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g358000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g43470.1   sequence type=CDS   gene model=Glyma13g43470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTCTTAGAGAAACCATTCGCAAGACCAGGGTTTTATTTCACAAGACCCTCCGAAGCTTCAAGTCTGTCATCTTTGGAGGGTACCAAAAACTTCCCAGATCTCTCTCCTTCAATCCTTTCGTCGGTCGAAGTGGAAATGCAAGAACTTACACAAGCGAGCAATTCTACAATGAGTTTTATGACATGCTGCAGTCTGATCTGAACAGAATAAAGAGGAGTGATAGCAATAGCATGAGCAGGTCGAGAGAGCATGCAATTGGAGATGCTGTGAACACTGAAATTCTTAGGAAGCAAAGTTCACAAAAAAGCATTGCTGAAGAGGGAGTAGTAGTGGAAGAGAAGAAAAACAAAGGGAGCTGTGAAATGGGAAAGAAGGAATGCTTGAATAATTCAAAAAGCATGAATGAGGGAGTTCATGATTTGGCGGAAAAGATGAAGGAATTGGAGATGATGGATACGGGTGATGTTGAGCACGAGCTAGACATTGAAGAGGCACTCCACTACTATTCACGTCTTAAAAGTCCTGTTTATTTAGACATCGTGGACAAGTTCTTCATGGACATGCACTCTGAATTCTCTGTTCAAGAGTCCTCTATCAGTGTCAAACGCTCTAAGTCAAAGGGAAGGCCTGACTCAATCAGGTTGTAG

>Glyma13g43470.1   sequence type=predicted peptide   gene model=Glyma13g43470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLLRETIRKTRVLFHKTLRSFKSVIFGGYQKLPRSLSFNPFVGRSGNARTYTSEQFYNEFYDMLQSDLNRIKRSDSNSMSRSREHAIGDAVNTEILRKQSSQKSIAEEGVVVEEKKNKGSCEMGKKECLNNSKSMNEGVHDLAEKMKELEMMDTGDVEHELDIEEALHYYSRLKSPVYLDIVDKFFMDMHSEFSVQESSISVKRSKSKGRPDSIRL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo