SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g43450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g43450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g43450

Feature Type:gene_model
Chromosome:Gm13
Start:43145463
stop:43146073
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g43450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16080AT Annotation by Michelle Graham. TAIR10: Zinc-binding ribosomal protein family protein | chr3:5454892-5455677 FORWARD LENGTH=95 SoyBaseE_val: 6.00E-56ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3475 KOG 60S ribosomal protein L37 JGI ISS
PTHR10768Panther 60S RIBOSOMAL PROTEIN L37 JGI ISS
PF01907PFAM Ribosomal protein L37e JGI ISS
UniRef100_I3T5Z7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L37 n=1 Tax=Lotus japonicus RepID=I3T5Z7_LOTJA SoyBaseE_val: 5.00E-58ISS
UniRef100_UPI00019AA976UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00019AA976 related cluster n=1 Tax=unknown RepID=UPI00019AA976 SoyBaseE_val: 3.00E-60ISS

Expression Patterns of Glyma13g43450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g43450 not represented in the dataset
Glyma13g43450 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g43450
ParalogEvidenceComments
Glyma15g01860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g43450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g357900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g43450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g43450
>Glyma13g43450.1   sequence type=CDS   gene model=Glyma13g43450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAAGGGAACAGGGAGCTTCGGTAAGAGGAGGAACAAGACCCACACTCTCTGTGTGAGGTGTGGCCGCCGCAGCTTCCACCTCCAGAAGAGTCGCTGCGCCGCTTGTGCTTTCCCCGCTGCACGCACGCGGAAATATAACTGGAGCGTCAAGGCAATTCGCAGAAAGACCACCGGAACTGGCAGGATGAGATACTTGCGTAACGTGCCTCGCCGTTTCAAGAGTGGCTTCAGAGAAGGTACCGAAGCTGCACCAAGGAAGAAGGGAGCAGCTACCACTGCATAG
Predicted protein sequences of Glyma13g43450
>Glyma13g43450.1   sequence type=predicted peptide   gene model=Glyma13g43450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAFPAARTRKYNWSVKAIRRKTTGTGRMRYLRNVPRRFKSGFREGTEAAPRKKGAATTA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo