SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g43090

Feature Type:gene_model
Chromosome:Gm13
Start:42865565
stop:42866693
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g43090
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G21360AT Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr3:7522865-7524036 FORWARD LENGTH=330 SoyBaseE_val: 1.00E-25ISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
PF02668PFAM Taurine catabolism dioxygenase TauD, TfdA family JGI ISS
UniRef100_G7IHZ5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Clavaminate synthase-like protein n=1 Tax=Medicago truncatula RepID=G7IHZ5_MEDTR SoyBaseE_val: 8.00E-27ISS
UniRef100_I1M5G5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M5G5_SOYBN SoyBaseE_val: 1.00E-122ISS

Expression Patterns of Glyma13g43090
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g43090
ParalogEvidenceComments
Glyma15g02280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g43090 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g354500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g43090
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g43090
>Glyma13g43090.1   sequence type=CDS   gene model=Glyma13g43090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAGTTCATTGGTGGAAATCCAAGTTCCCGGGCAGAAGCTTGTGAACGGAGTTCCATTCCCCGCTGTGGTGTCTCCTCCACCTGCAACTGCAAGTTCGGTTCCTCTCAGGGACTCCGTCAAAACCCAAAAAGCTTTCCTTGAATCATTACTAGAGAAGCATGGTTTGTTGTACACCAGGGTTTTAGGAGAAGACGACAACCCTAACTCTCCAATTGGCCGTGGCTTGAAATCAACCTTCTTGACCAATCACAAGACCCTCGCTCAACAAAGTGAAATCTTACAATATGGTCAACCATTACCCTCTCACATTGTCTATGATTGTCTCCACATTCTGGAGGAAGAATCTGTTGCCATTCCTTGGCAAAAAGGGGACGTTCTCTTGATTGATAATTGGGCCGTCCTTTATTCCAGAAGATCTTTTGATCCACCTTGTCAATTAAGGTCTGTATTATACCAACGTATTAGAAACAAGAACTGCTTCAGCAGTAATAGCAGAACCATGAATTATTAA
Predicted protein sequences of Glyma13g43090
>Glyma13g43090.1   sequence type=predicted peptide   gene model=Glyma13g43090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSSLVEIQVPGQKLVNGVPFPAVVSPPPATASSVPLRDSVKTQKAFLESLLEKHGLLYTRVLGEDDNPNSPIGRGLKSTFLTNHKTLAQQSEILQYGQPLPSHIVYDCLHILEEESVAIPWQKGDVLLIDNWAVLYSRRSFDPPCQLRSVLYQRIRNKNCFSSNSRTMNY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo