Glyma13g42820 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g42820

Feature Type:	gene_model
Chromosome:	Gm13
Start:	42682406
stop:	42684307
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g42820

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G51700	AT	Annotation by Michelle Graham. TAIR10: DOF zinc finger protein 1 \| chr1:19174266-19174850 FORWARD LENGTH=194	SoyBase	E_val: 2.00E-43	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PF02701	PFAM	Dof domain, zinc finger	JGI		ISS
UniRef100_G8A2U0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Dof zinc finger protein n=1 Tax=Medicago truncatula RepID=G8A2U0_MEDTR	SoyBase	E_val: 1.00E-75	ISS
UniRef100_I1M5E0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1M5E0_SOYBN	SoyBase	E_val: 3.00E-152	ISS

Expression Patterns of Glyma13g42820

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g42820

Paralog	Evidence	Comments
Glyma15g02620	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g42820 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g352000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g42820

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g42820

Limit To All Plant Sequences

>Glyma13g42820.1   sequence type=CDS   gene model=Glyma13g42820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGATCCAACGTTGTTCCAACCCATGAAACCCCACTTTCCCGAACAGGAACAACTTAAATGCCCGCGCTGTGACTCCACCAACACCAAGTTCTGCTACTACAACAACTACAACCTCTCGCAGCCACGCCATTTTTGCAAGAACTGCAGAAGGTATTGGACCAAAGGTGGCGCCTTGAGAAACATCCCCGTTGGTGGTGGAAGCAGAAAGAACACAAAGCGATCATCTTCATCCAACAACAACACCAAACACGCTTCTCCATCACCCCCAGTTTCTTCTGCACCCGCTCCAGAAATCGACCCGACCCGAACTGACCCCAACCCGGTTGGTGGTGGTGGGTCTTTCCGTTCCCTTTTGGCATCGAGTGGCCATTTGGGCCTAGGGAACCTCTTGGAGGGTCTGAATTCAAGTGGGTCTAATCTCAAAAGTGTGCAAATGGAAGAGTTTGGGGAGAATGTTAGTTCGGGTACTCCAGTGGCGGTTCCGGGTTCGGGTCAGAATCCCGGGTTGGAGATGCAAAGCAATGGGAATGCTGAGAGTTTTCTGAGTTTGCAAAATGGTGATTCAGGCTGTTGTAATGGTACTAATGGCTGGTCTAACCTTGCTATTTTCACTCCTGGGTCAAGCTATCAGTAA

Predicted protein sequences of Glyma13g42820

Limit To All Plant Sequences

>Glyma13g42820.1   sequence type=predicted peptide   gene model=Glyma13g42820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQDPTLFQPMKPHFPEQEQLKCPRCDSTNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGSRKNTKRSSSSNNNTKHASPSPPVSSAPAPEIDPTRTDPNPVGGGGSFRSLLASSGHLGLGNLLEGLNSSGSNLKSVQMEEFGENVSSGTPVAVPGSGQNPGLEMQSNGNAESFLSLQNGDSGCCNGTNGWSNLAIFTPGSSYQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain