Report for Sequence Feature Glyma13g42730
Feature Type: gene_model
Chromosome: Gm13
Start: 42624421
stop: 42625588
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma13g42730
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G55190 AT
Annotation by Michelle Graham. TAIR10: PRA1 (Prenylated rab acceptor) family protein | chr1:20588450-20589019 FORWARD LENGTH=189
SoyBase E_val: 1.00E-73 ISS
GO:0016192 GO-bp
Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport
SoyBase N/A ISS
GO:0005774 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane
SoyBase N/A ISS
GO:0005783 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
KOG3142
KOG
Prenylated rab acceptor 1
JGI ISS
PTHR19317 Panther
PRENYLATED RAB ACCEPTOR 1-RELATED
JGI ISS
PF03208 PFAM
PRA1 family protein
JGI ISS
UniRef100_B7FKD8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: PRA1 family protein F2 n=1 Tax=Medicago truncatula RepID=B7FKD8_MEDTR
SoyBase E_val: 1.00E-74 ISS
UniRef100_I1M5D1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M5D1_SOYBN
SoyBase E_val: 3.00E-126 ISS
Expression Patterns of Glyma13g42730
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma13g42730
Paralog Evidence Comments
Glyma15g02700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma13g42730 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g351200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g42730
Coding sequences of Glyma13g42730
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g42730.1 sequence type=CDS gene model=Glyma13g42730 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACCAACTACGGCACAATTCCAACCTCCTCCTCGCCTTCGACCAACCTCGACTTCATCTCACGCGCCAAGCAGCGCGTCAAGGAGGGCCTCGGAACCCGCCGTCCATGGAAGCTCATGTTCAATTTCCGATCCTTCGGTCTCCCCGCCGGGGTCGGAGACGCCGTCGCGCGTGTGAGGGAGAACATCTCCTACTTCCAGATGAACTACGCGATCGTCGTGCTCATCGTGCTGTTCCTGAGTCTTCTATGGCATCCAATCTCGCTGATCGTGTTCGTCGTGCTCATGGCGGCGTGGCTCTTCCTCTACTTCCTCCGCGACGAACCGCTAATCATCTTCGGAAGACTAATCAGCGACCGCGTCGTGCTTATCGTTATGGCGGTGCTGACCGTCGTGCTGCTGCTTCTCACCGGCGCCATCGGCAACATCCTGGTGGCGCTGCTCATCGGAGCGGTGTTGATAGTGGCGCACGCGGCGTTGAGGAAAACCGATGATTTGTTCTTGGACGAAGAAGAGGCCACTGGATTCTCTCCTCCCGGTGCTCCTCTCTCTTGA
Predicted protein sequences of Glyma13g42730
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g42730.1 sequence type=predicted peptide gene model=Glyma13g42730 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTNYGTIPTSSSPSTNLDFISRAKQRVKEGLGTRRPWKLMFNFRSFGLPAGVGDAVARVRENISYFQMNYAIVVLIVLFLSLLWHPISLIVFVVLMAAWLFLYFLRDEPLIIFGRLISDRVVLIVMAVLTVVLLLLTGAIGNILVALLIGAVLIVAHAALRKTDDLFLDEEEATGFSPPGAPLS*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
