Glyma13g41531 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g41531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g41531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g41531

Feature Type:	gene_model
Chromosome:	Gm13
Start:	41805060
stop:	41807163
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g41531

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G63530	AT	Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein \| chr3:23456407-23457787 REVERSE LENGTH=248	SoyBase	E_val: 4.00E-22	ISS
GO:0016567	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein ubiquitination	SoyBase	N/A	ISS
GO:0046621	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of organ growth	SoyBase	N/A	ISS
GO:0048437	GO-bp	Annotation by Michelle Graham. GO Biological Process: floral organ development	SoyBase	N/A	ISS
GO:0051865	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein autoubiquitination	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0031624	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin conjugating enzyme binding	SoyBase	N/A	ISS
PTHR14155	Panther	RING FINGER PROTEIN 6/12/38	JGI		ISS
PTHR14155:SF11	Panther	OS03G0173900 PROTEIN	JGI		ISS
UniRef100_G7JDP3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: E3 ubiquitin-protein ligase n=2 Tax=Medicago truncatula RepID=G7JDP3_MEDTR	SoyBase	E_val: 4.00E-73	ISS
UniRef100_UPI000233AF38	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233AF38 related cluster n=1 Tax=unknown RepID=UPI000233AF38	SoyBase	E_val: 5.00E-92	ISS

Expression Patterns of Glyma13g41531

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g41531 not represented in the dataset	Glyma13g41531 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g41531 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g340400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g41531

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g41531

Limit To All Plant Sequences

>Glyma13g41531.1   sequence type=CDS   gene model=Glyma13g41531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTACTTTCCAGGCAGATAGAATTCAAGATGAGTTGGAACCCATGCATGGAGGTCCGTTACAATAACATTAGCTATCCCTACAGTGCAGCAGGAACCTTTATTGAATATGTTGAAGGTCTTACATACGAACATGTTAACTTCATTTTTTCTGGTGCCTCTCATGCTCAGGAGAATTCATACCCTTTAACTACAAACTTTTACAAATCTGGGCTATCTGAACCAGAGAGTACCTCATACTATCAGGACAGTCATGGTTATGAGGTGAATCATCATGAACCATTGATGGATGAGTATATAAGACCTTCAGAAGTCTCTGCACAATCAATGAACATATGCCAACAACATCATAATAATTCCAATGATAATCAGGTCATTTGGGAAGATAATGTTGATCCTGATAACATGACGTATGAGGAACTACTTGAATTAGGGGAGACAGTTGGAACTCAGAGCCATGGTATCTCCCAAGAATAG

Predicted protein sequences of Glyma13g41531

Limit To All Plant Sequences

>Glyma13g41531.1   sequence type=predicted peptide   gene model=Glyma13g41531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LLSRQIEFKMSWNPCMEVRYNNISYPYSAAGTFIEYVEGLTYEHVNFIFSGASHAQENSYPLTTNFYKSGLSEPESTSYYQDSHGYEVNHHEPLMDEYIRPSEVSAQSMNICQQHHNNSNDNQVIWEDNVDPDNMTYEELLELGETVGTQSHGISQE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain