SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g41531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g41531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g41531

Feature Type:gene_model
Chromosome:Gm13
Start:41805060
stop:41807163
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G63530AT Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein | chr3:23456407-23457787 REVERSE LENGTH=248 SoyBaseE_val: 4.00E-22ISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0046621GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of organ growth SoyBaseN/AISS
GO:0048437GO-bp Annotation by Michelle Graham. GO Biological Process: floral organ development SoyBaseN/AISS
GO:0051865GO-bp Annotation by Michelle Graham. GO Biological Process: protein autoubiquitination SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0031624GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin conjugating enzyme binding SoyBaseN/AISS
PTHR14155Panther RING FINGER PROTEIN 6/12/38 JGI ISS
PTHR14155:SF11Panther OS03G0173900 PROTEIN JGI ISS
UniRef100_G7JDP3UniRef Annotation by Michelle Graham. Most informative UniRef hit: E3 ubiquitin-protein ligase n=2 Tax=Medicago truncatula RepID=G7JDP3_MEDTR SoyBaseE_val: 4.00E-73ISS
UniRef100_UPI000233AF38UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AF38 related cluster n=1 Tax=unknown RepID=UPI000233AF38 SoyBaseE_val: 5.00E-92ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g41531 not represented in the dataset

Glyma13g41531 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g340400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g41531.1   sequence type=CDS   gene model=Glyma13g41531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTACTTTCCAGGCAGATAGAATTCAAGATGAGTTGGAACCCATGCATGGAGGTCCGTTACAATAACATTAGCTATCCCTACAGTGCAGCAGGAACCTTTATTGAATATGTTGAAGGTCTTACATACGAACATGTTAACTTCATTTTTTCTGGTGCCTCTCATGCTCAGGAGAATTCATACCCTTTAACTACAAACTTTTACAAATCTGGGCTATCTGAACCAGAGAGTACCTCATACTATCAGGACAGTCATGGTTATGAGGTGAATCATCATGAACCATTGATGGATGAGTATATAAGACCTTCAGAAGTCTCTGCACAATCAATGAACATATGCCAACAACATCATAATAATTCCAATGATAATCAGGTCATTTGGGAAGATAATGTTGATCCTGATAACATGACGTATGAGGAACTACTTGAATTAGGGGAGACAGTTGGAACTCAGAGCCATGGTATCTCCCAAGAATAG

>Glyma13g41531.1   sequence type=predicted peptide   gene model=Glyma13g41531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LLSRQIEFKMSWNPCMEVRYNNISYPYSAAGTFIEYVEGLTYEHVNFIFSGASHAQENSYPLTTNFYKSGLSEPESTSYYQDSHGYEVNHHEPLMDEYIRPSEVSAQSMNICQQHHNNSNDNQVIWEDNVDPDNMTYEELLELGETVGTQSHGISQE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo