Glyma13g41300 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g41300

Feature Type:	gene_model
Chromosome:	Gm13
Start:	41643565
stop:	41644502
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g41300

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G59510	AT	Annotation by Michelle Graham. TAIR10: ROTUNDIFOLIA like 5 \| chr5:23990089-23990523 FORWARD LENGTH=144	SoyBase	E_val: 5.00E-20	ISS
GO:0015824	GO-bp	Annotation by Michelle Graham. GO Biological Process: proline transport	SoyBase	N/A	ISS
GO:0048367	GO-bp	Annotation by Michelle Graham. GO Biological Process: shoot development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF08137	PFAM	DVL family	JGI		ISS
UniRef100_G7JUW7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DVL9 n=1 Tax=Medicago truncatula RepID=G7JUW7_MEDTR	SoyBase	E_val: 2.00E-26	ISS
UniRef100_UPI000233AE02	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233AE02 related cluster n=1 Tax=unknown RepID=UPI000233AE02	SoyBase	E_val: 3.00E-62	ISS

Expression Patterns of Glyma13g41300

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g41300

Paralog	Evidence	Comments
Glyma15g04110	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g41300 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g338000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g41300

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g41300

Limit To All Plant Sequences

>Glyma13g41300.2   sequence type=CDS   gene model=Glyma13g41300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGAAAAGAGAAAGTCATCATCAAAGAAGGACACGGGTTCCTCTTCCACAAGGTCATTATTCTCAAGGAGCACCTCTACTTCAAACTCTCCTCTCCTTAGAAGCCTGTCTCAAAAGAGTTCTTCATCTTCCTCCAAATGCAATAACAATAATCTTCCTAGGAGCTTCTCACAGAAGAACCCTTCCATTGGGCGCAAATGCACCAAATTAGCTAAGGAACAGAAAGCACGGTTTTACATCATGAGGAGGTGTGTTGCCATGTTGGTTTGCTGGCACAAGCATGGGGATTCATGA

Predicted protein sequences of Glyma13g41300

Limit To All Plant Sequences

>Glyma13g41300.2   sequence type=predicted peptide   gene model=Glyma13g41300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDEKRKSSSKKDTGSSSTRSLFSRSTSTSNSPLLRSLSQKSSSSSSKCNNNNLPRSFSQKNPSIGRKCTKLAKEQKARFYIMRRCVAMLVCWHKHGDS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain