Glyma13g41195 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g41195): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g41195): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g41195

Feature Type:	gene_model
Chromosome:	Gm13
Start:	41573228
stop:	41575460
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g41195

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G59420	AT	Annotation by Michelle Graham. TAIR10: OSBP(oxysterol binding protein)-related protein 3C \| chr5:23961731-23964623 FORWARD LENGTH=457	SoyBase	E_val: 1.00E-17	ISS
GO:0008202	GO-bp	Annotation by Michelle Graham. GO Biological Process: steroid metabolic process	SoyBase	N/A	ISS
GO:0009610	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to symbiotic fungus	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0009697	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009863	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0045087	GO-bp	Annotation by Michelle Graham. GO Biological Process: innate immune response	SoyBase	N/A	ISS
GO:0046482	GO-bp	Annotation by Michelle Graham. GO Biological Process: para-aminobenzoic acid metabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0008142	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxysterol binding	SoyBase	N/A	ISS
PTHR10972	Panther	OXYSTEROL-BINDING PROTEIN	JGI		ISS
PTHR10972:SF8	Panther	OXYSTEROL-BINDING PROTEIN-RELATED	JGI		ISS
PF01237	PFAM	Oxysterol-binding protein	JGI		ISS
UniRef100_D7MSE7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Oxysterol-binding family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MSE7_ARALL	SoyBase	E_val: 3.00E-15	ISS
UniRef100_UPI000233AF2A	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233AF2A related cluster n=1 Tax=unknown RepID=UPI000233AF2A	SoyBase	E_val: 3.00E-93	ISS

Expression Patterns of Glyma13g41195

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g41195 not represented in the dataset	Glyma13g41195 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g41195 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma13g41195

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g41195

Limit To All Plant Sequences

>Glyma13g41195.1   sequence type=CDS   gene model=Glyma13g41195   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTAGCCCCGAGAAGAATGAAAATAAGGGCTTTTTCGCCACCATGACTTCCGGCTTCTCCATGTTCAGCAGCGCCATGCACCGATCTGTCAACGGGTATTTTTACCAACAAACGCCATGGGCTATATCTGTGTACTTTGCATATCAACGAACCAGGAAGCCTTTTAACCCTATCCTTGGAGAGACTTATGAGATGGCTAACCATGGTGGAATTACATTTCTTGCAGAACAGTTGGTAGCAGCTATGGACATGTCACATGTCATTTTTAAGATTGGTTATAAAGGAGTTGTAGATAGAATTCAGGGTCATAGGATTGATTTTTCTGAAATCGGAGCCTTGGTGATTGAATGTAAGGCTCTTCTTTCTTCTTTTCCGAACTTTTCTGTGAAGTTTGTGCGGAGACAATCTAATATAACTGCTCATTTTAATGCAAGGGCAGTCATCAACTATGCTTCTACATACTTAGCAGTGTGCGTGTAA

Predicted protein sequences of Glyma13g41195

Limit To All Plant Sequences

>Glyma13g41195.1   sequence type=predicted peptide   gene model=Glyma13g41195   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSPEKNENKGFFATMTSGFSMFSSAMHRSVNGYFYQQTPWAISVYFAYQRTRKPFNPILGETYEMANHGGITFLAEQLVAAMDMSHVIFKIGYKGVVDRIQGHRIDFSEIGALVIECKALLSSFPNFSVKFVRRQSNITAHFNARAVINYASTYLAVCV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain