SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g41140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g41140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g41140

Feature Type:gene_model
Chromosome:Gm13
Start:41537799
stop:41538212
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g41140
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G31380AT Annotation by Michelle Graham. TAIR10: FPF1-like protein 1 | chr4:15229837-15230382 FORWARD LENGTH=181 SoyBaseE_val: 4.00E-30ISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_Q5Q0B3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Flowering-promoting factor 1-like protein 1 n=1 Tax=Arabidopsis thaliana RepID=FLP1_ARATH SoyBaseE_val: 5.00E-28ISS
UniRef100_UPI000233ADB3UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233ADB3 related cluster n=1 Tax=unknown RepID=UPI000233ADB3 SoyBaseE_val: 1.00E-97ISS

Expression Patterns of Glyma13g41140
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g41140 not represented in the dataset
Glyma13g41140 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g41140
ParalogEvidenceComments
Glyma15g04265 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g41140 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g336400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g41140
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g41140
>Glyma13g41140.2   sequence type=CDS   gene model=Glyma13g41140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGGTGTTTGGGTTTTTGACAAGAAAGGAGTGGCGAGGCTCATAACAAACCCAACAAGGGAATCCTTCGAGCAGAAAGAGCCAAGACAACCTGGTACAGCCACCGCACCCGGTGCAAGACCAAGAGTCTTGGTGTATCTCCCAAGCAACCAGGTCATTCGTTCCTACGCCGAACTCGAGCAGCGACTCACTGAACTCGGTTGGACTCGCTACCGTGACTCGGACCGCTCTGACCTCATCCAGTTCCACCGCTCAGACACCTCCTCCCACCTTATCTCCCTCCCCAAAAACTTCTCCAACTTTAAGCACTTCCACTTCTACGACATCGTCGTTAAAAATCGCTCTTTCTTTCAAGTTCGTGACCCCACTATGCAATACCAAGACTATTGTGACAACGATATTTCAAGTTAA
Predicted protein sequences of Glyma13g41140
>Glyma13g41140.2   sequence type=predicted peptide   gene model=Glyma13g41140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGVWVFDKKGVARLITNPTRESFEQKEPRQPGTATAPGARPRVLVYLPSNQVIRSYAELEQRLTELGWTRYRDSDRSDLIQFHRSDTSSHLISLPKNFSNFKHFHFYDIVVKNRSFFQVRDPTMQYQDYCDNDISS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo