Glyma13g41000 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g41000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g41000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g41000

Feature Type:	gene_model
Chromosome:	Gm13
Start:	41409414
stop:	41410496
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g41000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G59340	AT	Annotation by Michelle Graham. TAIR10: WUSCHEL related homeobox 2 \| chr5:23933408-23934627 REVERSE LENGTH=260	SoyBase	E_val: 7.00E-43	ISS
GO:0008284	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation	SoyBase	N/A	ISS
GO:0009880	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification	SoyBase	N/A	ISS
GO:0009942	GO-bp	Annotation by Michelle Graham. GO Biological Process: longitudinal axis specification	SoyBase	N/A	ISS
GO:0010654	GO-bp	Annotation by Michelle Graham. GO Biological Process: apical cell fate commitment	SoyBase	N/A	ISS
GO:0048825	GO-bp	Annotation by Michelle Graham. GO Biological Process: cotyledon development	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0090451	GO-bp	Annotation by Michelle Graham. GO Biological Process: cotyledon boundary formation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PF00046	PFAM	Homeobox domain	JGI		ISS
UniRef100_B9SZE2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor, putative n=1 Tax=Ricinus communis RepID=B9SZE2_RICCO	SoyBase	E_val: 1.00E-50	ISS
UniRef100_I1M4V5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M4V5_SOYBN	SoyBase	E_val: 2.00E-158	ISS

Expression Patterns of Glyma13g41000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g41000 not represented in the dataset	Glyma13g41000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g41000

Paralog	Evidence	Comments
Glyma15g04460	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g41000 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g334900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g41000

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g41000

Limit To All Plant Sequences

>Glyma13g41000.1   sequence type=CDS   gene model=Glyma13g41000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAGTCACAGTAGTGATGCTGAGGCGGAGAATGTAAGGACTCATTCATCAGTTTCACGGTGGAGTCCTACAAAGGAGCAAATAGACATGTTAGAGAACCTTTACAAGCAGGGAATAAGGACTCCCAGCACTGAGCAAATACAACAGATTACCTCTAGGCTCAGGGCTTATGGTCACATCGAGGGAAAGAATGTCTTCTACTGGTTTCAAAATCACAAAGCTCGTCAAAGACAGAAGCTGATGAAGCAACAAACCATTGCATATTCCAATCGCTTTCTTCGTGCCTCCCACCCCATTTGCCAAAATGTTGCCTGCGCTCCATATTGTTTGCAACGGAGTGGATTCAGCTTTTATCCTCAACAATCGAAGGTGCTTGCAAGTGGAGGTATAAGTTCAACTGGGCCTTTAGGCATGCAAAGAATGTTTGATGGCATGCAGAGTAGTGAACACCCGGATTGTAACCGTGAAGTCTTAACTCTCTTTCCTCTTCATCCAACCGGCATTTTGAAAGAAAAAACAACTCATCAAGTGCCTTCCCTTGCTTCAACTTCTGTTGTTGCTGTTGATGAAGATGGTCATCTTGGAAATCAGCCCTTCTTTAATTTTTTCACTACTGAACCAAGGTCGAGAGAGTGA

Predicted protein sequences of Glyma13g41000

Limit To All Plant Sequences

>Glyma13g41000.1   sequence type=predicted peptide   gene model=Glyma13g41000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESHSSDAEAENVRTHSSVSRWSPTKEQIDMLENLYKQGIRTPSTEQIQQITSRLRAYGHIEGKNVFYWFQNHKARQRQKLMKQQTIAYSNRFLRASHPICQNVACAPYCLQRSGFSFYPQQSKVLASGGISSTGPLGMQRMFDGMQSSEHPDCNREVLTLFPLHPTGILKEKTTHQVPSLASTSVVAVDEDGHLGNQPFFNFFTTEPRSRE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain