Glyma13g40920 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g40920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g40920): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g40920

Feature Type:	gene_model
Chromosome:	Gm13
Start:	41345428
stop:	41345999
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g40920

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G39350	AT	Annotation by Michelle Graham. TAIR10: cellulose synthase A2 \| chr4:18297078-18301890 FORWARD LENGTH=1084	SoyBase	E_val: 3.00E-91	ISS
GO:0009832	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis	SoyBase	N/A	ISS
GO:0009833	GO-bp	Annotation by Michelle Graham. GO Biological Process: primary cell wall biogenesis	SoyBase	N/A	ISS
GO:0016049	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell growth	SoyBase	N/A	ISS
GO:0019761	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process	SoyBase	N/A	ISS
GO:0030243	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process	SoyBase	N/A	ISS
GO:0030244	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
GO:0016759	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cellulose synthase activity	SoyBase	N/A	ISS
GO:0016760	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cellulose synthase (UDP-forming) activity	SoyBase	N/A	ISS
PTHR13301	Panther	X-BOX TRANSCRIPTION FACTOR-RELATED	JGI		ISS
PTHR13301:SF1	Panther	TGACG-MOTIF-BINDING FACTOR	JGI		ISS
PF03552	PFAM	Cellulose synthase	JGI		ISS
UniRef100_B9GTH4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cellulose synthase n=1 Tax=Populus trichocarpa RepID=B9GTH4_POPTR	SoyBase	E_val: 6.00E-97	ISS
UniRef100_I1MP59	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MP59_SOYBN	SoyBase	E_val: 8.00E-102	ISS

Expression Patterns of Glyma13g40920

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g40920 not represented in the dataset	Glyma13g40920 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g40920 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma13g40920

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g40920

Limit To All Plant Sequences

>Glyma13g40920.1   sequence type=CDS   gene model=Glyma13g40920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGTTTGAGAAGAAGTTTGGGCAATCATCTGTTTTCATAGCTTCAACACTCTTGGAAGATGGGGGTGTTCCAAAAGCAGCAAGTTCTGCTACACTCTTGAAAGAGGCCATCCATGTAATTAGTTGTGGTTATGAAGATAAGACAGAATGGGGGAAAGAGGTTGGGTGGATATATGGTTCAGTTACCGAAGATATTTTAACAGGTTTCAAGATGCATTGTCATGGTTGGAGATCTGTATACTGCATGCCAAAAAGGCCTGCTTTTAAAGGTTCAACTCCTATAAATCTCTCAGACCGTCTGCATCAAGTTCTTCGGTGGGCTCTTGGATCTGTTGAGATCTTTTTCAGTAGGCATTGTCCCATATGGTATGGCTATATCTCTTACATAAACTCAGTTATTTATCCTCTAACTTCAATTCCCTTAATTGCCTATTGTGCATTGCCAACTGTCTGTCTGCTCACAGGGAAGTTCATTGTCCCCGAG

Predicted protein sequences of Glyma13g40920

Limit To All Plant Sequences

>Glyma13g40920.1   sequence type=predicted peptide   gene model=Glyma13g40920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KFEKKFGQSSVFIASTLLEDGGVPKAASSATLLKEAIHVISCGYEDKTEWGKEVGWIYGSVTEDILTGFKMHCHGWRSVYCMPKRPAFKGSTPINLSDRLHQVLRWALGSVEIFFSRHCPIWYGYISYINSVIYPLTSIPLIAYCALPTVCLLTGKFIVPE

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain