Glyma13g40780 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g40780

Feature Type:	gene_model
Chromosome:	Gm13
Start:	41248179
stop:	41249716
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g40780

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G55280	AT	Annotation by Michelle Graham. TAIR10: ribosomal protein L23AB \| chr3:20500667-20501519 FORWARD LENGTH=154	SoyBase	E_val: 2.00E-66	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0042254	GO-bp	Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG1751	KOG	60s ribosomal protein L23	JGI		ISS
PTHR11620	Panther	60S RIBOSOMAL PROTEIN L23A	JGI		ISS
PF00276	PFAM	Ribosomal protein L23	JGI		ISS
PF03939	PFAM	Ribosomal protein L23, N-terminal domain	JGI		ISS
UniRef100_I1M4S4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M4S4_SOYBN	SoyBase	E_val: 3.00E-102	ISS
UniRef100_O22644	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L23A n=1 Tax=Fritillaria agrestis RepID=RL23A_FRIAG	SoyBase	E_val: 4.00E-79	ISS

Expression Patterns of Glyma13g40780

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g40780

Paralog	Evidence	Comments
Glyma15g04670	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g40780 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g332700	Wm82.a2.v1	IGC	As supplied by JGI
Glyma13g40771	Wm82.a1.v1.1	IGC	Correspondences based on a combination of genome sequence coordinate overlap (fjoin) and sequence similarity (ungapped blastn)

References for Glyma13g40780

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma13g40780

Limit To All Plant Sequences

>Glyma13g40780.2   sequence type=transcript   gene model=Glyma13g40780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCCGTTGCCTCTGCCTCTCACCCGCAGGTTGTGCTCTATTCCCCCATTCTCTCTCCGTTTAGTTCACAGTATATTTCACCAGCCTTATCTTCATCTTCTTTTTCTTTTAGGGTTTAGAGAAAATTTAACAATTAGGGTTGCTTCTCCTTTGCCGACCCATGGCTCCCAAAGCTGATAGTTCAAAGAAGGCTGATCCAAAGGCACAGGCCTTGAAAACTGCCAAGGCAGTTAAGTCCGGTGCTAACTTTAAGAAGAAGACCAAGAAGATCCGAACATCTGTTACCTTCCATCGACCAAGGACTTTGAAAAAGGATAGGAACCCCAAATATCCACGCATTAGTGCTCCACCCAGGAACAAGCTTGATCACTATCAGATATTGAAGTTTCCTCTCACGACTGAGTCTGCAATGAAGAAGATTGAAGACAACAACACTTTGGTTTTCATTGTTGACTTGCGGGCCGACAAGAAGAAGATCAAGGATGCAGTCAAGAAGATGTATGATATTCAGGCCAAGAAAGTAAACACCTTGATCAGGCCTGATGGAACCAAGAAGGCCTATGTCAGGTTGACACCTGATTATGACGCCCTGGATGTGGCCAACAAGATTGGAATTATCTAAACTAATATATGGCCTCACCAAAGTAGATTTCTGTTTAGATGGTAGTTTGTTATGGGGTGTTGAGGGGAGACATTTGAAGCAACATTAAGTTATAAATTTTCGGTTTGTTATCTGGTGTATTTTAGTTCAATTGGAATTATATTTACTTTTGTTACAATTTTCAATTTGATGAGTAAATGGGCCGATATTATTTTCCAATCATATACTGAATTTAATTTTGATGCACCATTAGTTTATAAATAAGGCATTGAGTATC

Coding sequences of Glyma13g40780

Limit To All Plant Sequences

>Glyma13g40780.1   sequence type=CDS   gene model=Glyma13g40780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCCAAAGCTGATAGTTCAAAGAAGGCTGATCCAAAGGCACAGGCCTTGAAAACTGCCAAGGCAGTTAAGTCCGGTGCTAACTTTAAGAAGAAGACCAAGAAGATCCGAACATCTGTTACCTTCCATCGACCAAGGACTTTGAAAAAGGATAGGAACCCCAAATATCCACGCATTAGTGCTCCACCCAGGAACAAGCTTGATCACTATCAGATATTGAAGTTTCCTCTCACGACTGAGTCTGCAATGAAGAAGATTGAAGACAACAACACTTTGGTTTTCATTGTTGACTTGCGGGCCGACAAGAAGAAGATCAAGGATGCAGTCAAGAAGATGTATGATATTCAGGCCAAGAAAGTAAACACCTTGATCAGGCCTGATGGAACCAAGAAGGCCTATGTCAGGTTGACACCTGATTATGACGCCCTGGATGTGGCCAACAAGATTGGAATTATCTAA

>Glyma13g40780.2   sequence type=CDS   gene model=Glyma13g40780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCCAAAGCTGATAGTTCAAAGAAGGCTGATCCAAAGGCACAGGCCTTGAAAACTGCCAAGGCAGTTAAGTCCGGTGCTAACTTTAAGAAGAAGACCAAGAAGATCCGAACATCTGTTACCTTCCATCGACCAAGGACTTTGAAAAAGGATAGGAACCCCAAATATCCACGCATTAGTGCTCCACCCAGGAACAAGCTTGATCACTATCAGATATTGAAGTTTCCTCTCACGACTGAGTCTGCAATGAAGAAGATTGAAGACAACAACACTTTGGTTTTCATTGTTGACTTGCGGGCCGACAAGAAGAAGATCAAGGATGCAGTCAAGAAGATGTATGATATTCAGGCCAAGAAAGTAAACACCTTGATCAGGCCTGATGGAACCAAGAAGGCCTATGTCAGGTTGACACCTGATTATGACGCCCTGGATGTGGCCAACAAGATTGGAATTATCTAA

Predicted protein sequences of Glyma13g40780

Limit To All Plant Sequences

>Glyma13g40780.1   sequence type=predicted peptide   gene model=Glyma13g40780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPKADSSKKADPKAQALKTAKAVKSGANFKKKTKKIRTSVTFHRPRTLKKDRNPKYPRISAPPRNKLDHYQILKFPLTTESAMKKIEDNNTLVFIVDLRADKKKIKDAVKKMYDIQAKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII*

>Glyma13g40780.2   sequence type=predicted peptide   gene model=Glyma13g40780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPKADSSKKADPKAQALKTAKAVKSGANFKKKTKKIRTSVTFHRPRTLKKDRNPKYPRISAPPRNKLDHYQILKFPLTTESAMKKIEDNNTLVFIVDLRADKKKIKDAVKKMYDIQAKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain