SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g40630): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g40630): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g40630

Feature Type:gene_model
Chromosome:Gm13
Start:41135203
stop:41136877
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g40630
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47710AT Annotation by Michelle Graham. TAIR10: Adenine nucleotide alpha hydrolases-like superfamily protein | chr2:19555045-19555956 REVERSE LENGTH=162 SoyBaseE_val: 9.00E-67ISS
GO:0002238GO-bp Annotation by Michelle Graham. GO Biological Process: response to molecule of fungal origin SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00582PFAM Universal stress protein family JGI ISS
UniRef100_E4MVN9UniRef Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-04-K19 n=1 Tax=Eutrema halophilum RepID=E4MVN9_THEHA SoyBaseE_val: 4.00E-66ISS
UniRef100_I1M4R0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M4R0_SOYBN SoyBaseE_val: 9.00E-117ISS

Expression Patterns of Glyma13g40630
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g40630 not represented in the dataset
Glyma13g40630 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g40630 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g331200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g40630
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g40630
>Glyma13g40630.1   sequence type=CDS   gene model=Glyma13g40630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAGTTCTCAAGAGAAGCGAATAATGGTGTTAGCCATGGATGCACATGAGCATAGCAACTATGCCTTGGAGTGGACCCTAGACCATTTCTTCACCCCTTTTGGTGCAAATGCTCCTTTCAATCTTGTTATCGTCAATGCCAAACCCTCTCCTCCCCCGGCTGTCAGTATGGCAGGACCTGGAGCCCTAGGATCTGAAATTTTTCCAGCCGTACAGGTGCAGCTGAAAGCGAATGCTGAACAAATTGCAGAAAAGGCAAAGCAATTTTGTGCCAGTAAATCGGTTCTTGAGGTGCTAGTGGAAGTGGTCGAAGGTGATGCTAGGAACGTGTTGTGTGATGCTGTAGACAGACACCGTGCATCTGTATTGGTTTTGGGTAGCCACGGCTACGGAGCTATCAAAAGAGCAGTTTTAGGAAGTGTGAGTGACCATTGTGCTCGTCATGCTCATTGTTCGGTGATGATTGTGAAGAGGCCCAAGTTCAAATATTAA
Predicted protein sequences of Glyma13g40630
>Glyma13g40630.1   sequence type=predicted peptide   gene model=Glyma13g40630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSQEKRIMVLAMDAHEHSNYALEWTLDHFFTPFGANAPFNLVIVNAKPSPPPAVSMAGPGALGSEIFPAVQVQLKANAEQIAEKAKQFCASKSVLEVLVEVVEGDARNVLCDAVDRHRASVLVLGSHGYGAIKRAVLGSVSDHCARHAHCSVMIVKRPKFKY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo