SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g39980

Feature Type:gene_model
Chromosome:Gm13
Start:40532885
stop:40537966
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g39980
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G28305AT Annotation by Michelle Graham. TAIR10: Putative lysine decarboxylase family protein | chr2:12081186-12084307 FORWARD LENGTH=213 SoyBaseE_val: 7.00E-130ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03641PFAM Possible lysine decarboxylase JGI ISS
UniRef100_B9SVB4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Carboxy-lyase, putative n=1 Tax=Ricinus communis RepID=B9SVB4_RICCO SoyBaseE_val: 4.00E-136ISS
UniRef100_I1LTK5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LTK5_SOYBN SoyBaseE_val: 3.00E-151ISS

Expression Patterns of Glyma13g39980
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g39980
ParalogEvidenceComments
Glyma12g29810 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g39980 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g324700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g39980
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g39980
>Glyma13g39980.1   sequence type=CDS   gene model=Glyma13g39980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAAGAAACAGAGATGAAGCAATCCAAGTTCAAGAGGATTTGTGTCTTCTGTGGCAGTAGTCCAGGGAACAAAACTAGTTATAAGGACGCTGCTATTGAGCTTGGAAGAGAATTGGTGTCAAGAAATATTGATCTAGTATATGGAGGGGGCAGCATTGGTTTGATGGGGTTGATTTCTCAGGCTGTTTACGAGGGTGGTCGCCATGTAACTGGAGTTATTCCCAAGACACTTATGCCAAGAGAGCTCACTGGAGAAACAGTGGGGGAAGTGAAGGCAGTAGCAGACATGCATCAAAGGAAAGCAGAGATGGCCAAGCGCTCTGATGCCTTTATTGCCTTACCCGGTGGCTATGGGACACTTGAGGAACTCCTTGAGGTGATAACATGGGCTCAACTTGGCATCCATGATAAACCGGTGGGATTGCTGAATGTTGATGGATACTACAATACCTTTTTGTCTTTCATTGACAAAGCGGTGGAGGAAGGCTTCATAAGCCCCACTGCTCGTCATATAATTGTATCTGCCCCAACACCAAAAGAGCTTGTCAAAGAGATGGAGGAATATTTCCCACAACACGAAAGAGTTGTCTCCAAGCTAAGCTGGGAAAGTGAACAGCTACATTAG
Predicted protein sequences of Glyma13g39980
>Glyma13g39980.1   sequence type=predicted peptide   gene model=Glyma13g39980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKETEMKQSKFKRICVFCGSSPGNKTSYKDAAIELGRELVSRNIDLVYGGGSIGLMGLISQAVYEGGRHVTGVIPKTLMPRELTGETVGEVKAVADMHQRKAEMAKRSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNTFLSFIDKAVEEGFISPTARHIIVSAPTPKELVKEMEEYFPQHERVVSKLSWESEQLH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo