Glyma13g39620 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g39620

Feature Type:	gene_model
Chromosome:	Gm13
Start:	40173038
stop:	40174831
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g39620

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G28200	AT	Annotation by Michelle Graham. TAIR10: C2H2-type zinc finger family protein \| chr2:12024321-12025181 FORWARD LENGTH=286	SoyBase	E_val: 1.00E-57	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0010228	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem	SoyBase	N/A	ISS
GO:0016926	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein desumoylation	SoyBase	N/A	ISS
GO:0048573	GO-bp	Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering	SoyBase	N/A	ISS
GO:0050665	GO-bp	Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR26374	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR26374:SF459	Panther		JGI		ISS
UniRef100_G7JN94	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ZPT2-11 n=1 Tax=Medicago truncatula RepID=G7JN94_MEDTR	SoyBase	E_val: 1.00E-73	ISS
UniRef100_I1M4G2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M4G2_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma13g39620

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g39620

Paralog	Evidence	Comments
Glyma12g30270	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g39620 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g321900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g39620

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g39620

Limit To All Plant Sequences

>Glyma13g39620.1   sequence type=CDS   gene model=Glyma13g39620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGTCACAAATGGACATGGAGGAGCTTGTCTCATGTAACAACAACGATGCCACCAACATAGCCAAAGGCAAGCGCACAAAGCGGCGCTTGAGGCCTTTGTCTCCTTGTGCCGTCGTTCCTACCACCACCACCATCACCACTGTCACTGCCGCTACCACCCCCATCATGACATCTAGCTGTTCAAGTGCTTCTTGTGGCGGTGGTTCTTCTTCATCCACAACCTTTGAGGAGGAAGAGGAAGACATGGCTAATTGTTTGATTCTCCTAGCACAAGGAAAAGTAGGAGGGGACCCTCCTCATCGTCACAAGGACTTATATGGTAGTGATGTTAAGACAGAGAAGCTGGGTAGCACCAAAGTCGATCATTTCTATGTTTATGAGTGCAAAACATGCAACCGAACATTCCCTTCTTTTCAAGCACTAGGTGGCCACAGGGCAAGTCACAAGAAGCCCAAGGTGGAGGAGAAAAAGTCGTCATCACCACCACTGTCGTTGCCGCCGCCGCCACCACCACCACCACCGTCTTCGTCGTCACTATTTAATTTTGAAGAAGCAAAACAAAGTCATCACATGAAGAATATTATTAGCCCTTCTGTTTCCCTTCAATTAGGGTGTGGCAATAATAACAAGGTTGGTTTAAATTTCCATGGCAACAAATCCAAGATTCACGAGTGTTCCATCTGTGGGTCAGAATTCACATCAGGGCAAGCATTGGGTGGTCACATGAGGAGGCATAGAGCATCTACCAATAATAACAATATTGTTCAGACAACAACAACAACTTCTAATGGTGCTGTTGATGTTAAGCCTCGGAATGTTCTAGAGTTGGATCTTAACCTCCCGGCGCCGGAAGACGATCTCCGGGACTCCAAATTTCAGTTTCCGGCGACTCAGAATTCTATGATGCGGTCGGCTGCTCCGGCTTTGGTGGGATGCCATTATTAG

Predicted protein sequences of Glyma13g39620

Limit To All Plant Sequences

>Glyma13g39620.1   sequence type=predicted peptide   gene model=Glyma13g39620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSQMDMEELVSCNNNDATNIAKGKRTKRRLRPLSPCAVVPTTTTITTVTAATTPIMTSSCSSASCGGGSSSSTTFEEEEEDMANCLILLAQGKVGGDPPHRHKDLYGSDVKTEKLGSTKVDHFYVYECKTCNRTFPSFQALGGHRASHKKPKVEEKKSSSPPLSLPPPPPPPPPSSSSLFNFEEAKQSHHMKNIISPSVSLQLGCGNNNKVGLNFHGNKSKIHECSICGSEFTSGQALGGHMRRHRASTNNNNIVQTTTTTSNGAVDVKPRNVLELDLNLPAPEDDLRDSKFQFPATQNSMMRSAAPALVGCHY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain