SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g39190

Feature Type:gene_model
Chromosome:Gm13
Start:39880160
stop:39881359
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g39190
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G15040AT Annotation by Michelle Graham. TAIR10: Protein of unknown function, DUF584 | chr3:5065445-5066176 REVERSE LENGTH=243 SoyBaseE_val: 9.00E-38ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04520PFAM Protein of unknown function, DUF584 JGI ISS
UniRef100_I1M4B8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1M4B8_SOYBN SoyBaseE_val: 4.00E-131ISS
UniRef100_Q944R0UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3g15040/K15M2_18 n=1 Tax=Arabidopsis thaliana RepID=Q944R0_ARATH SoyBaseE_val: 1.00E-34ISS

Expression Patterns of Glyma13g39190
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g39190
ParalogEvidenceComments
Glyma12g31120 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g39190 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g315700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g39190
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g39190
>Glyma13g39190.2   sequence type=CDS   gene model=Glyma13g39190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCTACACGACCCGAACCGGTTCCGCAACCGCAAACAAACCCTCTCCTCGCGGGAACGCTTCCTCGGCGTCCCATCATCCCACGCGCCTCGAATCGAAAACTCTTCCTCCTCCGCCACCGACGACGACGTCGTCGTTTTCTCCAACAACGACGACCTAATCGAAGACGATGTCGTTTTCTCCAACAATGACGACTCCACCGAACCCTCTTCTTCTTCTCAAATCCCTAATCGCCACCACAACCACAATAACCACCACAAAGCCTTCGCGTTCGGTCCCTCCGACGCTTCGTTCGGCATCCTCGCCGCGCTGCCGGAGAACGACCACGCCTCCTCGAACGGCTCGCACTTCTTCCACCACAAACCCTCGGTTTCCGTCTCCGTCTCTGTCTCGCTCTCCTCGTCCTCCTCCTCCTCCGCCGCCGCGCGCCTCATTCCGGCGATCCCGAAGCCCCCGCCGGAGCGGACTCCCTCCTCCTCCTCCTCCCTCAAGTTCCACCAGTCCGCGCCGGTGAACGTGCCGCTTATGCCGATGAGAAGACACCACCGCCGCGACTTCGATGACGACGACGACGCGACGGAGGAGATGCTGCCGCCGCACGAAATTGTGGCGCGGAATTCTGCGCAGTCACCAATGCTGGCTTATTCGGTTCTTGAAGGAGTAGGGAGGACGCTCAAGGGGAGAGACTTGCGTCAGGTTCGGAATGCCGTTTGGCGCCAAACGGGTTTTCTCGATTGA
Predicted protein sequences of Glyma13g39190
>Glyma13g39190.2   sequence type=predicted peptide   gene model=Glyma13g39190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLHDPNRFRNRKQTLSSRERFLGVPSSHAPRIENSSSSATDDDVVVFSNNDDLIEDDVVFSNNDDSTEPSSSSQIPNRHHNHNNHHKAFAFGPSDASFGILAALPENDHASSNGSHFFHHKPSVSVSVSVSLSSSSSSSAAARLIPAIPKPPPERTPSSSSSLKFHQSAPVNVPLMPMRRHHRRDFDDDDDATEEMLPPHEIVARNSAQSPMLAYSVLEGVGRTLKGRDLRQVRNAVWRQTGFLD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo