Glyma13g38621 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g38621): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g38621): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g38621

Feature Type:	gene_model
Chromosome:	Gm13
Start:	39380384
stop:	39380991
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g38621

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG00190	AT	Annotation by Michelle Graham. TAIR10: RNA polymerase subunit beta \| chrC:23111-26329 REVERSE LENGTH=1072	SoyBase	E_val: 4.00E-95	ISS
GO:0006091	GO-bp	Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy	SoyBase	N/A	ISS
GO:0006351	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0009295	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleoid	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003899	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0032549	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ribonucleoside binding	SoyBase	N/A	ISS
PTHR20856	Panther	DNA-DIRECTED RNA POLYMERASE I SUBUNIT 2	JGI		ISS
PTHR20856:SF3	Panther	DNA-DIRECTED RNA POLYMERASE BETA CHAIN	JGI		ISS
PF00562	PFAM	RNA polymerase Rpb2, domain 6	JGI		ISS
UniRef100_Q8HVY5	UniRef	Annotation by Michelle Graham. Best UniRef hit: DNA-directed RNA polymerase subunit beta n=1 Tax=Glycine max RepID=RPOB_SOYBN	SoyBase	E_val: 8.00E-100	ISS
UniRef100_Q8HVY5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA-directed RNA polymerase subunit beta n=1 Tax=Glycine max RepID=RPOB_SOYBN	SoyBase	E_val: 8.00E-100	ISS

Expression Patterns of Glyma13g38621

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g38621 not represented in the dataset	Glyma13g38621 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g38621 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma13g38621

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g38621

Limit To All Plant Sequences

>Glyma13g38621.1   sequence type=CDS   gene model=Glyma13g38621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CATTTGCTCAGAAATTTAGACAAAAATGGAATTGTGATCCTTAGGTCGTGGATAGAAACAGGTCATATTTTAGTGGGTAAATTAACACCTCAAATGGTAAAAGAATCCTCGTATTCCCCAGAAGATAGATTATTACGAGTTATACTTGGCATTCAGGTATTCACCTTAAAGGAAACTTGTCTACTACCTACAAGTGGTAGGGGGGGGTCCAGTTATGATCCAGAAACAATTCGTATATATATTTTACAAAAATGTGAAATTAAAGTAGGAGATAAAGTGGTTAGGAGACACCGAAATAGAGGTATCGTTTCAAAAATTTTGTCTAGACAAGATATGCCTTATTTGCAAGATGGAAGACCCATTGATATGGTCTTCAATCCACTAGGGGTACCTTCACGAATGAATGTAGGGCAAATATTTGAATGCTTGCTCGGATTAGCAGGAAGTATGCTAGAAAGACATTATCAAATAACACCTTTTAATGAGACATATGAACAAGAAGCTTCAAGAAAACTAGTGCTTTCTGAATTATATGAAGCCAGTAAACAAACACGTCAATCAAAAATGCTCTAA

Predicted protein sequences of Glyma13g38621

Limit To All Plant Sequences

>Glyma13g38621.1   sequence type=predicted peptide   gene model=Glyma13g38621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
HLLRNLDKNGIVILRSWIETGHILVGKLTPQMVKESSYSPEDRLLRVILGIQVFTLKETCLLPTSGRGGSSYDPETIRIYILQKCEIKVGDKVVRRHRNRGIVSKILSRQDMPYLQDGRPIDMVFNPLGVPSRMNVGQIFECLLGLAGSMLERHYQITPFNETYEQEASRKLVLSELYEASKQTRQSKML*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain