SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g38420): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g38420): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g38420

Feature Type:gene_model
Chromosome:Gm13
Start:39172715
stop:39175168
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20570AT Annotation by Michelle Graham. TAIR10: RING-box 1 | chr5:6956905-6958221 REVERSE LENGTH=136 SoyBaseE_val: 7.00E-73ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0016925GO-bp Annotation by Michelle Graham. GO Biological Process: protein sumoylation SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0042752GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of circadian rhythm SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0019005GO-cc Annotation by Michelle Graham. GO Cellular Compartment: SCF ubiquitin ligase complex SoyBaseN/AISS
GO:0031463GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Cul3-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
KOG2930 KOG SCF ubiquitin ligase, Rbx1 component JGI ISS
PTHR11210Panther RING FINGER JGI ISS
UniRef100_C6T2R2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2R2_SOYBN SoyBaseE_val: 2.00E-77ISS
UniRef100_F4K5K1UniRef Annotation by Michelle Graham. Most informative UniRef hit: RING-box protein 1 n=1 Tax=Arabidopsis thaliana RepID=F4K5K1_ARATH SoyBaseE_val: 3.00E-70ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g38420 not represented in the dataset

Glyma13g38420 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g32060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g308100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g38420.2   sequence type=transcript   gene model=Glyma13g38420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACACTGGATTCCGACGTGACCATGGTTCCGGCCGGCGAACCCTCCACCAGCGCCGGTCCTTCTTCGTCCACCAAGAAGCCGAAGCGATTCGAGATCAAGAAGTGGAATGCCGTTTCTCTCTGGGCTTGGGGTTCGTCTCTCTCTCCGCTTTCTACAAACCCTAATTTTCTTTTCTCTCTTTTAGTTTATTATTTTCTTTCTGTTATTGCAGATATTGTTGTGGATAATTGCGCTATTTGCCGCAACCATATCATGGATCTCTGTATTGAGTGCCAGGCCAACCAGGCTAGCGCCACTAGCGAGGAATGCACTGTAGCTTGGGGAGTTTGTAACCATGCTTTTCACTTCCATTGCATAAGCCGATGGCTCAAGACCCGTCAAGTATGTCCTCTAGATAATAGCGAGTGGGAGTTTCAGAAATACGGTCACTAG

>Glyma13g38420.1   sequence type=CDS   gene model=Glyma13g38420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACACTGGATTCCGACGTGACCATGGTTCCGGCCGGCGAACCCTCCACCAGCGCCGGTCCTTCTTCGTCCACCAAGAAGCCGAAGCGATTCGAGATCAAGAAGTGGAATGCCGTTTCTCTCTGGGCTTGGGATATTGTTGTGGATAATTGCGCTATTTGCCGCAACCATATCATGGATCTCTGTATTGAGTGCCAGGCCAACCAGGCTAGCGCCACTAGCGAGGAATGCACTGTAGCTTGGGGAGTTTGTAACCATGCTTTTCACTTCCATTGCATAAGCCGATGGCTCAAGACCCGTCAAGTATGTCCTCTAGATAATAGCGAGTGGGAGTTTCAGAAATACGGTCACTAG

>Glyma13g38420.2   sequence type=CDS   gene model=Glyma13g38420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACACTGGATTCCGACGTGACCATGGTTCCGGCCGGCGAACCCTCCACCAGCGCCGGTCCTTCTTCGTCCACCAAGAAGCCGAAGCGATTCGAGATCAAGAAGTGGAATGCCGTTTCTCTCTGGGCTTGGGGTTCGTCTCTCTCTCCGCTTTCTACAAACCCTAATTTTCTTTTCTCTCTTTTAGTTTATTATTTTCTTTCTGTTATTGCAGATATTGTTGTGGATAATTGCGCTATTTGCCGCAACCATATCATGGATCTCTGTATTGAGTGCCAGGCCAACCAGGCTAGCGCCACTAGCGAGGAATGCACTGTAGCTTGGGGAGTTTGTAACCATGCTTTTCACTTCCATTGCATAAGCCGATGGCTCAAGACCCGTCAAGTATGTCCTCTAGATAATAGCGAGTGGGAGTTTCAGAAATACGGTCACTAG

>Glyma13g38420.1   sequence type=predicted peptide   gene model=Glyma13g38420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATLDSDVTMVPAGEPSTSAGPSSSTKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH*

>Glyma13g38420.2   sequence type=predicted peptide   gene model=Glyma13g38420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATLDSDVTMVPAGEPSTSAGPSSSTKKPKRFEIKKWNAVSLWAWGSSLSPLSTNPNFLFSLLVYYFLSVIADIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo