Glyma13g38065 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g38065): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g38065): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g38065

Feature Type:	gene_model
Chromosome:	Gm13
Start:	38980773
stop:	38983867
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g38065

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G25810	AT	Annotation by Michelle Graham. TAIR10: Terpenoid cyclases/Protein prenyltransferases superfamily protein \| chr3:9430805-9433844 FORWARD LENGTH=598	SoyBase	E_val: 2.00E-16	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0043693	GO-bp	Annotation by Michelle Graham. GO Biological Process: monoterpene biosynthetic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0000287	GO-mf	Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0010333	GO-mf	Annotation by Michelle Graham. GO Molecular Function: terpene synthase activity	SoyBase	N/A	ISS
GO:0010334	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sesquiterpene synthase activity	SoyBase	N/A	ISS
GO:0016829	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lyase activity	SoyBase	N/A	ISS
GO:0034002	GO-mf	Annotation by Michelle Graham. GO Molecular Function: (R)-limonene synthase activity	SoyBase	N/A	ISS
GO:0034768	GO-mf	Annotation by Michelle Graham. GO Molecular Function: (E)-beta-ocimene synthase activity	SoyBase	N/A	ISS
GO:0050550	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pinene synthase activity	SoyBase	N/A	ISS
GO:0050551	GO-mf	Annotation by Michelle Graham. GO Molecular Function: myrcene synthase activity	SoyBase	N/A	ISS
GO:0050552	GO-mf	Annotation by Michelle Graham. GO Molecular Function: (4S)-limonene synthase activity	SoyBase	N/A	ISS
GO:0080015	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sabinene synthase activity	SoyBase	N/A	ISS
PF03936	PFAM	Terpene synthase family, metal binding domain	JGI		ISS
UniRef100_Q6EJ97	UniRef	Annotation by Michelle Graham. Best UniRef hit: Isoprene synthase, chloroplastic n=1 Tax=Pueraria montana var. lobata RepID=ISPS_PUEML	SoyBase	E_val: 3.00E-34	ISS
UniRef100_Q6EJ97	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Isoprene synthase, chloroplastic n=1 Tax=Pueraria montana var. lobata RepID=ISPS_PUEML	SoyBase	E_val: 3.00E-34	ISS

Expression Patterns of Glyma13g38065

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g38065 not represented in the dataset	Glyma13g38065 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g38065 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g304800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g38065

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g38065

Limit To All Plant Sequences

>Glyma13g38065.1   sequence type=CDS   gene model=Glyma13g38065   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTTCACAACAACAAAGTGATTCCACCATTCAACGAGTTCCTCAAAAATGGATAGATCTCGTCCGGAGGTGGGGTTGTTCTCGCTCATTGCTACTTCTTATAGTCTGCCAAGACCAAGACGTCACGGAGCAAGCACTTCATTCTTTAGCTAACTACCATGACTTCTTGCGCCCTGCAATGATCATTTTAAGGCTTTGCGATGATTTAGGAACATCAACGGACGAGATGAAGATGGGTGAAATCTCAACTTCAATTGCAAGCTACATGCACGAAAACGGTCTTTCAGAAGAAAAAGTCCATCAATACTTCAAGACTTTGATTGATAAAGAATGGCAGTACTTAAATAAAGGCCAAGTTATGGGCTCTACACTCTCCAAATCTGTCATACAAGTTGCGATTGACCTTGGTCGAACGGCTCGATATACATACCAATGTGGAGATGGCATTGGAAGACAAGACGGTATAACAAAGAGGAGAATGAAGTTGTGGCTCGTAGATCCTGTTGAAGTTAATGAGGCTTCATGA

Predicted protein sequences of Glyma13g38065

Limit To All Plant Sequences

>Glyma13g38065.1   sequence type=predicted peptide   gene model=Glyma13g38065   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSQQQSDSTIQRVPQKWIDLVRRWGCSRSLLLLIVCQDQDVTEQALHSLANYHDFLRPAMIILRLCDDLGTSTDEMKMGEISTSIASYMHENGLSEEKVHQYFKTLIDKEWQYLNKGQVMGSTLSKSVIQVAIDLGRTARYTYQCGDGIGRQDGITKRRMKLWLVDPVEVNEAS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain