|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G28220 | AT | Annotation by Michelle Graham. TAIR10: NAD(P)H dehydrogenase B1 | chr4:13993078-13995651 FORWARD LENGTH=571 | SoyBase | E_val: 3.00E-23 | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005777 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: peroxisome | SoyBase | N/A | ISS |
| GO:0031314 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extrinsic to mitochondrial inner membrane | SoyBase | N/A | ISS |
| GO:0003954 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase activity | SoyBase | N/A | ISS |
| GO:0015036 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: disulfide oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0016491 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0050660 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding | SoyBase | N/A | ISS |
| UniRef100_B9RW71 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: NADH dehydrogenase, putative n=1 Tax=Ricinus communis RepID=B9RW71_RICCO | SoyBase | E_val: 1.00E-23 | ISS |
| UniRef100_C5Z889 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein Sb10g027690 n=1 Tax=Sorghum bicolor RepID=C5Z889_SORBI | SoyBase | E_val: 8.00E-25 | ISS |
|
Glyma13g37670 not represented in the dataset |
Glyma13g37670 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma13g37670.1 sequence type=CDS gene model=Glyma13g37670 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGACCCTGAACAGTTAAAGTTATACACAAGATATTTTCTATTTCTAATAGGTAGGAAATGGACCAACATGTTCCTAGCATTTTGGGTTTCCATGGAGAGCGGAGACTGGGTTTCCATGGGTCACAGCACTCAATGGCTTTGGTATTCTATATATGAAAGCAAACAAGTGAGCTGGCGCACAAGGGTGGTAGTCATTTCAGGTTGGACAAGAAGATTCATATTTGGGAGAGATTCTAGTCGTATTTAA
>Glyma13g37670.1 sequence type=predicted peptide gene model=Glyma13g37670 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDPEQLKLYTRYFLFLIGRKWTNMFLAFWVSMESGDWVSMGHSTQWLWYSIYESKQVSWRTRVVVISGWTRRFIFGRDSSRI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||