SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G20860 | AT | Annotation by Michelle Graham. TAIR10: lipoic acid synthase 1 | chr2:8979636-8980983 FORWARD LENGTH=374 | SoyBase | E_val: 0 | ISS |
| GO:0000096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process | SoyBase | N/A | ISS |
| GO:0006546 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycine catabolic process | SoyBase | N/A | ISS |
| GO:0006636 | GO-bp | Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0006733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process | SoyBase | N/A | ISS |
| GO:0006766 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process | SoyBase | N/A | ISS |
| GO:0008652 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process | SoyBase | N/A | ISS |
| GO:0009073 | GO-bp | Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process | SoyBase | N/A | ISS |
| GO:0009106 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process | SoyBase | N/A | ISS |
| GO:0009107 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipoate biosynthetic process | SoyBase | N/A | ISS |
| GO:0009108 | GO-bp | Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process | SoyBase | N/A | ISS |
| GO:0009117 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process | SoyBase | N/A | ISS |
| GO:0009695 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009965 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis | SoyBase | N/A | ISS |
| GO:0015995 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process | SoyBase | N/A | ISS |
| GO:0019288 | GO-bp | Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway | SoyBase | N/A | ISS |
| GO:0019344 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process | SoyBase | N/A | ISS |
| GO:0019748 | GO-bp | Annotation by Michelle Graham. GO Biological Process: secondary metabolic process | SoyBase | N/A | ISS |
| GO:0030154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell differentiation | SoyBase | N/A | ISS |
| GO:0044272 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process | SoyBase | N/A | ISS |
| GO:0045893 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005759 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial matrix | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0016992 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: lipoate synthase activity | SoyBase | N/A | ISS |
| GO:0051536 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding | SoyBase | N/A | ISS |
| GO:0051539 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: 4 iron, 4 sulfur cluster binding | SoyBase | N/A | ISS |
| KOG2672 | KOG | Lipoate synthase | JGI | ISS | |
| PTHR10949 | Panther | LIPOIC ACID SYNTHETASE | JGI | ISS | |
| PTHR10949:SF0 | Panther | LIPOYL SYNTHASE | JGI | ISS | |
| PF04055 | PFAM | Radical SAM superfamily | JGI | ISS | |
| UniRef100_Q3LSN5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Lipoyl synthase 2, mitochondrial n=1 Tax=Pisum sativum RepID=LIAS2_PEA | SoyBase | E_val: 0 | ISS |
| UniRef100_UPI0001D62D98 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0001D62D98 related cluster n=1 Tax=unknown RepID=UPI0001D62D98 | SoyBase | E_val: 0 | ISS |
|
Glyma13g37570 not represented in the dataset |
Glyma13g37570 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma12g32890 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.13g299900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma13g37570.1 sequence type=CDS gene model=Glyma13g37570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATGATGCATTCACGGATCAGAAGCGTCGCCGGAAACATCAAATGCGCGGCGAGACTCTTCTGTTCATCTTCGACGATCACGCCGGCGGCGGCGCCGTCGCAGCTCCCGCAGACTCTGGCGGGTCTCCGAGCCCGGCTGGCGGAGGAATCGCCGTCGCTGTCGGATTTCGTCGCGCTTAAATCGGACAGCGCGTACTCAGTGGAGGTCGGGACGAAGAAGAAGCCGCTTCCGAAGCCGAAGTGGATGAAGGAGGCCGTTCCCGGCGGCGAGAAGTACGTGCAGATCAAGAAGAAGCTCCGCGAATTGAAGCTCCACACGGTTTGCGAGGAGGCGAAGTGCCCTAATTTGGGGGAGTGCTGGTCCGGCGGCGAGACAGGCACTGCCACCGCCACTATCATGATTCTCGGCGACACGTGTACTCGAGGTTGCAGATTTTGTAATGTTAAGACATCCAGGACTCCTCCACCACCTGACCCTGATGAGCCCACCAATGTGGCTGAAGCAATTGCATCATGGGGCCTGGATTATGTGGTTATAACGAGTGTTGACCGTGATGATTTACCTGATCAAGGGAGTGGTCATTTTTCTGAAACAGTGCAGAAGCTGAAGGCACTGAAGCCAAATATGCTGATAGAAGCCTTAGTTCCAGATTTTCGAGGAGATGCTGACTGTGTAGAGAAGGTTGCCAAATCAGGATTAGATGTCTTTGCACATAACATTGAGACAGTCGAAGAGCTTCAGAATTTTGTACGGGACCATCGCGCTAATTTTAAGCAGTCATTAGATGTTCTAATGATGGCCAAGGAATATGCGCCTGCTGGAACACTTACTAAGACTTCAATAATGTTAGGTTGTGGGGAAACACCTGATCAGGTTGTGAAGACAATGGAGAAGGTGAGAGCGGCTGGTGTTGATGTGATGACATTTGGTCAGTATATGAGACCTTCAAAGCGCCATATGCCGGTATCTGAATATGTTACCCCAGAGGCCTTTGATAAGTATCAGAAACTTGGCATGGAAATGGGCTTTCGATATGTGGCATCTGGGCCCATGGTGAGGTCATCATACAAGGCAGGTGAATTCTATATCAAATCCATGATTGAATCAGATCGGGCCGCTTTCCCTCAAAGCTGA
>Glyma13g37570.1 sequence type=predicted peptide gene model=Glyma13g37570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MMMHSRIRSVAGNIKCAARLFCSSSTITPAAAPSQLPQTLAGLRARLAEESPSLSDFVALKSDSAYSVEVGTKKKPLPKPKWMKEAVPGGEKYVQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRTPPPPDPDEPTNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFSETVQKLKALKPNMLIEALVPDFRGDADCVEKVAKSGLDVFAHNIETVEELQNFVRDHRANFKQSLDVLMMAKEYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFDKYQKLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAFPQS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
