Glyma13g37510 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g37510): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g37510): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g37510

Feature Type:	gene_model
Chromosome:	Gm13
Start:	38573391
stop:	38574336
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g37510

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G03600	AT	Annotation by Michelle Graham. TAIR10: photosystem II family protein \| chr1:898916-899440 FORWARD LENGTH=174	SoyBase	E_val: 2.00E-62	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0010206	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II repair	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0035304	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009543	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0030095	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast photosystem II	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_B9RG39	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II 11 kDa protein, putative n=1 Tax=Ricinus communis RepID=B9RG39_RICCO	SoyBase	E_val: 1.00E-69	ISS
UniRef100_I1M3V1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M3V1_SOYBN	SoyBase	E_val: 8.00E-115	ISS

Expression Patterns of Glyma13g37510

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g37510 not represented in the dataset	Glyma13g37510 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g37510

Paralog	Evidence	Comments
Glyma12g32970	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g37510 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g299200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g37510

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g37510

Limit To All Plant Sequences

>Glyma13g37510.1   sequence type=CDS   gene model=Glyma13g37510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCCCCAACACTAATAACCCCCAAATCAGTCAAATCACTCTCACCCATCAAGCCCAAAGCCACCACCACCACCACCACCATCGCCGCCACTCTCACACCATCCACCACCACCCACCCTCGCCGCCGGGAATTGTTGTCCATCATCACCACCACATGGTTGCTCCCTCTGAGCCCGGCACTGGCATCCTCGGACGAGGAATACGTGAAGGAGACAGAGGAAGTGATCAACAAAGTGAGGACGACAATCGTGATGGACAAGAATGACCCCAACGTGGCAACCGCGGTAGCGGAGTTAAGAGAAACCTCGAACTCCTGGGTGGCAAAGTACAGGAGGGAGAAAGCGCTTCTTGGACGCGCTTCCTTTAGGGACATATATTCCGCGCTCAACGCTGTGTCGGGACACTACATTAGCTTCGGACCAACCGCTCCCATTCCCGCCAAACGAAGGGCAAGGATCTTGGAGGAGGTCGACACTGCTGAAAAGGCGCTTCTAAGGGGAAGATGA

Predicted protein sequences of Glyma13g37510

Limit To All Plant Sequences

>Glyma13g37510.1   sequence type=predicted peptide   gene model=Glyma13g37510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASPTLITPKSVKSLSPIKPKATTTTTTIAATLTPSTTTHPRRRELLSIITTTWLLPLSPALASSDEEYVKETEEVINKVRTTIVMDKNDPNVATAVAELRETSNSWVAKYRREKALLGRASFRDIYSALNAVSGHYISFGPTAPIPAKRRARILEEVDTAEKALLRGR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain