SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g37201

Feature Type:gene_model
Chromosome:Gm13
Start:38351861
stop:38352857
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g37201
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G20970AT Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein | chr4:11215259-11216212 FORWARD LENGTH=190 SoyBaseE_val: 5.00E-22ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00010PFAM Helix-loop-helix DNA-binding domain JGI ISS
UniRef100_G7JTT7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bHLH36 n=1 Tax=Medicago truncatula RepID=G7JTT7_MEDTR SoyBaseE_val: 1.00E-51ISS
UniRef100_UPI000233BD7DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BD7D related cluster n=1 Tax=unknown RepID=UPI000233BD7D SoyBaseE_val: 3.00E-133ISS

Expression Patterns of Glyma13g37201
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g37201 not represented in the dataset
Glyma13g37201 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma13g37201 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g296100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g37201
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g37201
>Glyma13g37201.1   sequence type=CDS   gene model=Glyma13g37201   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGATCATCAGCAGGGAGATCAACCTTCTTCAACCAAAGGGATCGAAAGAAGGATTGTAGAAAAAAACAGGAGAAACCATATGAAGAACCTCTGTTCCATGCTTAACTCTCTTCTCCCTAACAACAATAACACCAGGGGAAGAGAATTATCACGTGTTGATCAAATAGACGAGGCTATCAACTACATCAAGAACCTAGAGACAAAGGTGAAGATGGCGCAGGAGAAGAAAGAAAGCTTAATATTGCAAAGGAAAAGATCTCGCAGTGGCGGTTCGAGTAGTACTTCTGAAGCACCGAAGATTGAGATTCATGAAGTGGGTTCCTCGCTACAAATCATTCTGACGTGTGGGCTTGATAACCAGATCATTTTCAGTGAAATTATTCGTATACTGCAGGAAGAAAACATAGTGGTCAAGAGTGTCCATTCTTCATCATTCGCTGGAAACTCAATGTTGAATGTTGTGCATGCAGAAATTCAGCAATATTCATTTCTTCTAGAAACAACCGCAATGAGTATTGAGAAATTGAGAAGGATTGTGGACATGCATGGAGGAAATTTTTAG
Predicted protein sequences of Glyma13g37201
>Glyma13g37201.1   sequence type=predicted peptide   gene model=Glyma13g37201   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADHQQGDQPSSTKGIERRIVEKNRRNHMKNLCSMLNSLLPNNNNTRGRELSRVDQIDEAINYIKNLETKVKMAQEKKESLILQRKRSRSGGSSSTSEAPKIEIHEVGSSLQIILTCGLDNQIIFSEIIRILQEENIVVKSVHSSSFAGNSMLNVVHAEIQQYSFLLETTAMSIEKLRRIVDMHGGNF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo