SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g37101

Feature Type:gene_model
Chromosome:Gm13
Start:38277892
stop:38278797
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g37101
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G03790AT Annotation by Michelle Graham. TAIR10: Zinc finger C-x8-C-x5-C-x3-H type family protein | chr1:954589-955770 FORWARD LENGTH=393 SoyBaseE_val: 1.00E-55ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0010187GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of seed germination SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR14493Panther UNKEMPT-RELATED JGI ISS
UniRef100_D9ZIU9UniRef Annotation by Michelle Graham. Most informative UniRef hit: C3HL domain class transcription factor n=1 Tax=Malus x domestica RepID=D9ZIU9_MALDO SoyBaseE_val: 1.00E-66ISS
UniRef100_UPI000233BD79UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BD79 related cluster n=1 Tax=unknown RepID=UPI000233BD79 SoyBaseE_val: 0ISS

Expression Patterns of Glyma13g37101
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g37101 not represented in the dataset
Glyma13g37101 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g37101
ParalogEvidenceComments
Glyma12g33320 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g37101 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g138400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g37101
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g37101
>Glyma13g37101.1   sequence type=CDS   gene model=Glyma13g37101   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TGGGAAATTTGCCACTGCCCTTTTGCACATCCGGGCGAAAAGGCACGCCGCCGTGACCCACGGCGGTACCACTACTCAGGAACAGTCTGTCCGGAGTATCGTCGTGGAGGGTGCAGCCGTGATGATGCATGCGAATACGCTCATGGCGTGTTCGAATGTTGGCTGCACCCTTCCAGGTACAGGACAGAGGCCTGTAAGGATGGCAGGAACTGCAAGAGAAAGGTGTGTTTTTTCGCACACACACCTCGCCAGCTGAGAATTTTACCGGTAACATCTTCACCCTCTTCAAATGACATGCCATGCAAGAAGAACCTTAAACAAGTGTTAAACCATGCTTCAAAAACAAACAACAACAACAACTGTTGCTTGTTTTGCCATTGTGGTGCTTCTTCTTCAGCCTCTCCAACCTCCACACTCTTCGGCATGTCGCATTTCTCGCCACCACTATCACCTTCCTCGTCCTCTTCACCACCTCCTTCTCCGTTGAAACCCAGAAACGCGGTTTCTCCTATTTCCCGTTACAGTGCTGTGAATGTGAACCCTCATCACGTGGTGAGTTACAAAGACGTGTTCACTGAATTGGTGAATTCTTTGGAGCGTTTGAGTTTCAACGAGGGTTCACCTGTTTCCGGTGCAAAAGCACCGAACTTTCCTTGGCTTGATGTTTCTCTGAACTGTGAGGAACAGCAACAGCAACAACAAAACCCTTTCATAGTTCCTTCTTTTGGCTGCGAAGATCAGCAGCAACAGAACCAGTTTATTTTTTCACCACCGTCCATTCAGACACCGACAAATGGGAAGTTCTGTAGCAACAGATTCATGGGCAACGACAACAACAACAAGGTTGTCGGTGGTGCTGACGTTAATGGCCCAGATCTGGCGTGGGTGAATGAGTTGCTGATGTAG
Predicted protein sequences of Glyma13g37101
>Glyma13g37101.1   sequence type=predicted peptide   gene model=Glyma13g37101   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
WEICHCPFAHPGEKARRRDPRRYHYSGTVCPEYRRGGCSRDDACEYAHGVFECWLHPSRYRTEACKDGRNCKRKVCFFAHTPRQLRILPVTSSPSSNDMPCKKNLKQVLNHASKTNNNNNCCLFCHCGASSSASPTSTLFGMSHFSPPLSPSSSSSPPPSPLKPRNAVSPISRYSAVNVNPHHVVSYKDVFTELVNSLERLSFNEGSPVSGAKAPNFPWLDVSLNCEEQQQQQQNPFIVPSFGCEDQQQQNQFIFSPPSIQTPTNGKFCSNRFMGNDNNNKVVGGADVNGPDLAWVNELLM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo