SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g36441): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g36441): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g36441

Feature Type:gene_model
Chromosome:Gm13
Start:37723808
stop:37725194
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g36441
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G20570AT Annotation by Michelle Graham. TAIR10: early nodulin-like protein 9 | chr3:7186754-7187453 REVERSE LENGTH=203 SoyBaseE_val: 4.00E-20ISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
UniRef100_G7JF09UniRef Annotation by Michelle Graham. Most informative UniRef hit: Early nodulin-like protein n=1 Tax=Medicago truncatula RepID=G7JF09_MEDTR SoyBaseE_val: 3.00E-42ISS
UniRef100_UPI000233CB8DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CB8D related cluster n=1 Tax=unknown RepID=UPI000233CB8D SoyBaseE_val: 2.00E-79ISS

Expression Patterns of Glyma13g36441
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g36441 not represented in the dataset
Glyma13g36441 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g36441
ParalogEvidenceComments
Glyma12g34100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g36441 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma13g36441
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g36441
>Glyma13g36441.1   sequence type=CDS   gene model=Glyma13g36441   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTACCATCATGTTAAGGTCTAATGAAGTAGTCCATGCCTTGGGCTTGTTCTGTATCTTGCTGATGGTGCATAAGGGTGATGCCTATGAATTTGTAGTTGGAGGCCAAAAAGGGTTGGGGTTGTTCAATTACCCTTCTGGTCAAGACTCAGTGATTCAAGTCAGGAGCCAAGACTATGCCATCATCAAGCTCAACCAATCAGGGCCTCACAACTTCATCAGTGGAAACAAAAACAGCTGTCTCAAAAACGAGAAGCTTGTGGTGATTGTGCTGGCAGACAGGAACAACAAAAACACAAACCAAACAAGCCCTCCCTCTCCTTCGTCTCCTGCTCCTTCTCCTTCCCTTTTGACACAGTCATTAGCTCCATTACCAGCACCTTCTCAGCAACAGGTTCCACCTCCACCATCTCCAGTGGCAGCACCTCCTCAGCAAGAGGCTCCTTCTCCAGCAACAAGTAACCCCACTCCAGCTCCTGTTAGTGATCAACCTTCTCCTCCTCATAATGATGCTTCTTCAATCTTGTTCAACTTTGCTGGTTCTGTTGGAGCATTCATTGCTTCAGTTCTGGTTTTTTCTTTGAGTGGAGTGTATGATATATGA
Predicted protein sequences of Glyma13g36441
>Glyma13g36441.1   sequence type=predicted peptide   gene model=Glyma13g36441   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATIMLRSNEVVHALGLFCILLMVHKGDAYEFVVGGQKGLGLFNYPSGQDSVIQVRSQDYAIIKLNQSGPHNFISGNKNSCLKNEKLVVIVLADRNNKNTNQTSPPSPSSPAPSPSLLTQSLAPLPAPSQQQVPPPPSPVAAPPQQEAPSPATSNPTPAPVSDQPSPPHNDASSILFNFAGSVGAFIASVLVFSLSGVYDI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo