Glyma13g36180 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g36180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g36180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g36180

Feature Type:	gene_model
Chromosome:	Gm13
Start:	37502793
stop:	37503630
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g36180

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G51060	AT	Annotation by Michelle Graham. TAIR10: histone H2A 10 \| chr1:18926948-18927443 FORWARD LENGTH=132	SoyBase	E_val: 2.00E-73	ISS
GO:0006334	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleosome assembly	SoyBase	N/A	ISS
GO:0000786	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleosome	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
KOG1756	KOG	Histone 2A	JGI		ISS
PTHR23430	Panther	HISTONE H2A	JGI		ISS
PF00125	PFAM	Core histone H2A/H2B/H3/H4	JGI		ISS
UniRef100_I1M3H1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Histone H2A n=1 Tax=Glycine max RepID=I1M3H1_SOYBN	SoyBase	E_val: 1.00E-86	ISS
UniRef100_UPI000189DA77	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000189DA77 related cluster n=1 Tax=unknown RepID=UPI000189DA77	SoyBase	E_val: 1.00E-95	ISS

Expression Patterns of Glyma13g36180

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g36180 not represented in the dataset	Glyma13g36180 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g36180

Paralog	Evidence	Comments
Glyma12g34370	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g36180 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g285900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma13g36180

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g36180

Limit To All Plant Sequences

>Glyma13g36180.1   sequence type=CDS   gene model=Glyma13g36180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAGTCGAGGAAAAACCCAGGGATCTGGCACAACCAAAAAGGGCATCTCCCGAAGCAACAAAGCTGGTCTCCAATTCCCAGTTGGTCGTATTGCTCGATACCTCAAGATTGGCAAGTATGCTGACCGTATCGGTTCTGGCGCTCCCGTGTATCTCGCCTCTGTTCTTGAATATCTTGCTGCTGAGGTTTTGGAGTTAGCGGGGAATGCCGCAATGGACAACAAGAAGACTCGTATTATGCCTCGCCATATCCAATTGGCTGTTAGGAATGATGAAGAGTTGAGCAGGCTTCTCGGAGATGTGACTATCGCCAGTGGTGGTGTGACACCTAACATTCACAACATGTTGCTGCCTAAGAAGGTTGGGACCTCGACCTCAACCTTTATGGGTCCTAGTGCCGATGATGACGACGCTTAA

Predicted protein sequences of Glyma13g36180

Limit To All Plant Sequences

>Glyma13g36180.1   sequence type=predicted peptide   gene model=Glyma13g36180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASRGKTQGSGTTKKGISRSNKAGLQFPVGRIARYLKIGKYADRIGSGAPVYLASVLEYLAAEVLELAGNAAMDNKKTRIMPRHIQLAVRNDEELSRLLGDVTIASGGVTPNIHNMLLPKKVGTSTSTFMGPSADDDDA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain