SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g36160): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g36160): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g36160

Feature Type:gene_model
Chromosome:Gm13
Start:37487374
stop:37488406
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G27250AT Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein | chr4:13642803-13644425 REVERSE LENGTH=354 SoyBaseE_val: 1.00E-54ISS
GO:0009062GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process SoyBaseN/AISS
GO:0009686GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellin biosynthetic process SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0044237GO-bp Annotation by Michelle Graham. GO Biological Process: cellular metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0045551GO-mf Annotation by Michelle Graham. GO Molecular Function: cinnamyl-alcohol dehydrogenase activity SoyBaseN/AISS
GO:0050662GO-mf Annotation by Michelle Graham. GO Molecular Function: coenzyme binding SoyBaseN/AISS
PTHR10366Panther NAD DEPENDENT EPIMERASE/DEHYDRATASE JGI ISS
PTHR10366:SF9Panther NAD(P)H STEROID DEHYDROGENASE-RELATED JGI ISS
PF01370PFAM NAD dependent epimerase/dehydratase family JGI ISS
UniRef100_B9S9Z8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cinnamoyl-CoA reductase, putative n=1 Tax=Ricinus communis RepID=B9S9Z8_RICCO SoyBaseE_val: 2.00E-57ISS
UniRef100_I1M3G9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1M3G9_SOYBN SoyBaseE_val: 7.00E-87ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g36160 not represented in the dataset

Glyma13g36160 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g34390 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g36160.1   sequence type=CDS   gene model=Glyma13g36160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACGATTACTTTTAAAGACAGCAATGGGAAGTGGAAACCTCTTGTTGATGAATCTTGCCAAATCCAAAGTGAACTTGTGTTGAAAACACAAGCAAGTGGGTGGGTTTATGCACTTTCAAAGCTTCTAACAGAAGAGGCAGCATTTAAGTTTGCAAAAGAGAATGGCATTGATCTTGTGTCAGTCATAACAACCACTGTTGCTGGCCCATTCTTCACTGCTAGTGTACCATCAAGTGTTAAAGTCCTACTGTCACCAATAACAGGTGAACCTGAGTTCTTCAAGATATTATCTGCTGTAAATGCACGAATAGGGTCAATTGCTTTAGTTCACATTGAAGATATATACAGTGCGCACATATTCCTAATGGAGCATTCTAATGCAGAA

>Glyma13g36160.1   sequence type=predicted peptide   gene model=Glyma13g36160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TITFKDSNGKWKPLVDESCQIQSELVLKTQASGWVYALSKLLTEEAAFKFAKENGIDLVSVITTTVAGPFFTASVPSSVKVLLSPITGEPEFFKILSAVNARIGSIALVHIEDIYSAHIFLMEHSNAE







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo