SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g36150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g36150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g36150

Feature Type:gene_model
Chromosome:Gm13
Start:37480146
stop:37483326
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g36150
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54600AT Annotation by Michelle Graham. TAIR10: Translation protein SH3-like family protein | chr5:22183046-22184403 FORWARD LENGTH=198 SoyBaseE_val: 3.00E-86ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0032544GO-bp Annotation by Michelle Graham. GO Biological Process: plastid translation SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0015934GO-cc Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1708 KOG Mitochondrial/chloroplast ribosomal protein L24 JGI ISS
PTHR12903Panther MITOCHONDRIAL RIBOSOMAL PROTEIN L24 JGI ISS
PF00467PFAM KOW motif JGI ISS
UniRef100_C6T0A2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T0A2_SOYBN SoyBaseE_val: 3.00E-138ISS
UniRef100_G7IHC1UniRef Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L24 n=1 Tax=Medicago truncatula RepID=G7IHC1_MEDTR SoyBaseE_val: 1.00E-101ISS

Expression Patterns of Glyma13g36150
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g36150 not represented in the dataset
Glyma13g36150 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g36150
ParalogEvidenceComments
Glyma12g34400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g36150 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g285600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g36150
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g36150
>Glyma13g36150.1   sequence type=CDS   gene model=Glyma13g36150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCCATGGCTGCGCTTCAGAGCTCAATGGTCGGTCTCTCCCTCTCCTCCAACTCTTTCTTAGGCCAACGCCTTTCTCCCATCACCCTCCCCTCTCTTCTTCCGGGTAAGTCAACAGAGAAGCAATGTCCTATTGTAATGAGGCTTAAACGATGGGAACGGAAGGAGTGTAAACCAAACAGCCTTCCTATCTTGCACAAAATGCATGTTAAACTTGGAGATACGGTGCAAGTCATATCTGGACGTGAAAGGGGTAAAGTTGGGGAGATTACTAAAATCTTCAAGCATAACAGCACTGTTATAGTGAAAGATTTAAATTTGAAGACAAAGCATGTGAAGAGTAGAGAAGAGGGGGAACCAGGGCAAATTATTAAGATTGAAGGTCCTATCCACAGCTCAAATGTGATGCTCTACTCCAAAGATCAGAAGGTAGCAAGCCGTGTGGGGCATAAAGTCCTTGATAATGGTAAAAAAGTCCGCTACCTTATAAAAACTGGTGAAATAATTGATAGTGCAGAGAACTGGAAGAAACTGAAGGAGGCTACTAAGCAAACTGAAGAAGCTACTGCTGCTGCTGCCTAG
Predicted protein sequences of Glyma13g36150
>Glyma13g36150.1   sequence type=predicted peptide   gene model=Glyma13g36150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAMAALQSSMVGLSLSSNSFLGQRLSPITLPSLLPGKSTEKQCPIVMRLKRWERKECKPNSLPILHKMHVKLGDTVQVISGRERGKVGEITKIFKHNSTVIVKDLNLKTKHVKSREEGEPGQIIKIEGPIHSSNVMLYSKDQKVASRVGHKVLDNGKKVRYLIKTGEIIDSAENWKKLKEATKQTEEATAAAA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo