SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g36070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g36070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g36070

Feature Type:gene_model
Chromosome:Gm13
Start:37429004
stop:37433767
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G20660AT Annotation by Michelle Graham. TAIR10: organic cation/carnitine transporter4 | chr3:7225271-7228510 REVERSE LENGTH=526 SoyBaseE_val: 0ISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0042631GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation SoyBaseN/AISS
GO:0046482GO-bp Annotation by Michelle Graham. GO Biological Process: para-aminobenzoic acid metabolic process SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009705GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0005351GO-mf Annotation by Michelle Graham. GO Molecular Function: sugar:hydrogen symporter activity SoyBaseN/AISS
GO:0015144GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate transmembrane transporter activity SoyBaseN/AISS
GO:0022857GO-mf Annotation by Michelle Graham. GO Molecular Function: transmembrane transporter activity SoyBaseN/AISS
KOG0255 KOG Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) JGI ISS
PTHR24064Panther FAMILY NOT NAMED JGI ISS
PTHR24064:SF41Panther SUBFAMILY NOT NAMED JGI ISS
PF00083PFAM Sugar (and other) transporter JGI ISS
UniRef100_A2Q643UniRef Annotation by Michelle Graham. Most informative UniRef hit: Major facilitator superfamily n=1 Tax=Medicago truncatula RepID=A2Q643_MEDTR SoyBaseE_val: 0ISS
UniRef100_UPI000233B970UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B970 related cluster n=1 Tax=unknown RepID=UPI000233B970 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g36070 not represented in the dataset

Glyma13g36070 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g34440 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g284900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g36070.1   sequence type=CDS   gene model=Glyma13g36070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGCCACATTCCCTTCCTCCGACATCCACGACCTCCGCTCGCCGATGCTACCAGCGGCGGCGGTGGCGGCGAAGAAGCCGGCGATGGAGAAGCTCTGCATCGACGACATGCTGCAGAAACACTGCGGCGAGTTCGGGCGGTGGCAGCTCAAGCACTTCATCCTCACCAGCCTCGCGTGGGCGCTCGAGGCCTTTCACACCATGGTCATGATCTTCGCCGACCGCGAACCGGACTGGAAGTGCGTCGCCGGCGCCGCCTGCGACGGCGGCGACTTGTGCGGTCTCTCGCCGGAGTCGAGGGAGTGGATCGGCGGCCGCGGCGGCTCCACGGTTTCCGATTGGGGTTTGATTTGCGGAGATAAGTTTAAGGTTGGATTGGTGCAGGCTGTTTTCTTCTTTGGCTGCATGATTGGTGCTGGAACATTTGGCCACCTCTCAGACTCCTCTTTAGGAAGGAAAGGCTCTCTCACAGTGGTTTGTGCCCTAAACACCATCTTCGGCTGCTTAACAGCCCTGTCCCCAAACTACTGGATCTACGTCCTCCTCCGCCTCCTCACCGGCTTCAGCAGCGGTGGCGTCGGCCTCACTGCCTTCGTCCTTGCCACCGAACCAATCGGCCCAACCAAACGTGGTGCAGCGGGTATGTCCACCTTCTACTTCTTCTCCGGTGGCATTGCACTTCTCTCAGGCATCGCCTACATCTTCCAAACATGGCGCTATCTATACATAGCTTCCTCCATCCCCTCCTTCCTCTACATCATCCTTGTCCTTCCCTTTATCTCCGAGTCTCCAAGATGGTACCTCATTCGTGGCAAAGTTACCGAAGCCATGAAACTCATGTCCACCATTGCTTCTTCCAATGGTAAACACCTTCCTGATGGTGTTCTCCTTGCACTTGACAACGAAACATCGCCCACAACAAACCAAGGTTCAGGCTATGACATAACAGAAATCATGACTTACAAAAACGAAAACAAAGATGCACTTATTGGGTCCATCATAGACGTGGTTTGTTCACCCATCACTCGTATGAGGTTGTTCATTGCGGTGGCTCTTAATTTCCTAGCCTCTGTGGTGTACTATGGGCTTAGTTTAAACGTCATGAACCTGGAAACCAACCTTTACGTGAACGTGATGCTGAACTCGGTGGCGGAGATGCCAGCCTTTACGATAACGGCGGTGCTTCTGGACCGGTTTGGACGGAAGCCATTGACGGTGGCAACGATGTGGTTCAGTGGGTTCTTTTGCTTGATGGGGAGTTTGGTGAGCAACGTTGGGGTGTGGAAGGTGGTGAGAATGGTGTGTGGTGTTTTGGGGATATTTGGGATGGCGGGGACTTATAATTTGCTGTTTATTTACACGGCGGAGCTGTTTCCGACAGTGGTGAGGAACGCCGCGCTCGGGTGTACTACTCAAGCGGCGCAAATGGGAGCGATATTGGCGCCGTTTGTGGTCGTTTTGGGAGGGTATTTGCCGTTTGCGGTGTTTGCAGCATGTGGGATAGTGGGAGGGATGTTTGCGTTTAATCTTCCCGAGACTCTAAACCAACCTCTCTATGATACATTTGGTGGACTGGAAGCTGGACTTGCTTGA

>Glyma13g36070.1   sequence type=predicted peptide   gene model=Glyma13g36070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAATFPSSDIHDLRSPMLPAAAVAAKKPAMEKLCIDDMLQKHCGEFGRWQLKHFILTSLAWALEAFHTMVMIFADREPDWKCVAGAACDGGDLCGLSPESREWIGGRGGSTVSDWGLICGDKFKVGLVQAVFFFGCMIGAGTFGHLSDSSLGRKGSLTVVCALNTIFGCLTALSPNYWIYVLLRLLTGFSSGGVGLTAFVLATEPIGPTKRGAAGMSTFYFFSGGIALLSGIAYIFQTWRYLYIASSIPSFLYIILVLPFISESPRWYLIRGKVTEAMKLMSTIASSNGKHLPDGVLLALDNETSPTTNQGSGYDITEIMTYKNENKDALIGSIIDVVCSPITRMRLFIAVALNFLASVVYYGLSLNVMNLETNLYVNVMLNSVAEMPAFTITAVLLDRFGRKPLTVATMWFSGFFCLMGSLVSNVGVWKVVRMVCGVLGIFGMAGTYNLLFIYTAELFPTVVRNAALGCTTQAAQMGAILAPFVVVLGGYLPFAVFAACGIVGGMFAFNLPETLNQPLYDTFGGLEAGLA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo