Report for Sequence Feature Glyma13g36020
Feature Type: gene_model
Chromosome: Gm13
Start: 37383657
stop: 37384856
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Expression Patterns of Glyma13g36020
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma13g36020 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.13g284500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma13g36020
Coding sequences of Glyma13g36020
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma13g36020.1 sequence type=CDS gene model=Glyma13g36020 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGACTCCAGCACTGTCACACGCCGTTGTCCTCTCCAGATCTGCGTGCGTGAGACCACGACCACACCACCACACCAAGAACATCATCTACGCACGAACTACCTCGGACAACCCCTCTTGCGCGAGCCGCCACCTACAAGACCAAAATCCACGCGCGTGATTTCGGGGCACCAGATCCGGATCAAAGCCATCAAAATCGGAGGAGCTAAAGAGGTTTGGCACTGGTTCCGCGACGAGCGACATAACATACTGTTTGAGGTAATTGGGCGTTTTGCAGGGAAGATTAGGTACTAG
Predicted protein sequences of Glyma13g36020
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma13g36020.1 sequence type=predicted peptide gene model=Glyma13g36020 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDSSTVTRRCPLQICVRETTTTPPHQEHHLRTNYLGQPLLREPPPTRPKSTRVISGHQIRIKAIKIGGAKEVWHWFRDERHNILFEVIGRFAGKIRY*