SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g35670): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g35670): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g35670

Feature Type:gene_model
Chromosome:Gm13
Start:37068752
stop:37069698
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54400AT Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr5:22090680-22091998 FORWARD LENGTH=292 SoyBaseE_val: 5.00E-115ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
PTHR10108Panther METHYLTRANSFERASE JGI ISS
PTHR10108:SF242Panther METHYLTRANSFERASE JGI ISS
PF08241PFAM Methyltransferase domain JGI ISS
UniRef100_B9SID2UniRef Annotation by Michelle Graham. Most informative UniRef hit: S-adenosylmethionine-dependent methyltransferase, putative n=1 Tax=Ricinus communis RepID=B9SID2_RICCO SoyBaseE_val: 4.00E-116ISS
UniRef100_UPI000233BBF7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BBF7 related cluster n=1 Tax=unknown RepID=UPI000233BBF7 SoyBaseE_val: 4.00E-175ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g35670 not represented in the dataset

Glyma13g35670 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g34910 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g280900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g35670.2   sequence type=CDS   gene model=Glyma13g35670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAAATCGACGAATAATAACAGAGACTGGACGCAGATGTACGCGATCTATGGAATGGAGCAATGGCAAACCCTAATATTCCTCTTGTGTCAGGCGATGCTGTTTTCTGTGCTGTCTGTTTTGTATCTTCTGTATTTCGATCTAGTCTGTAGCTTTTTCGAGAGAATCTTCTCCGGCGGCGGCGGCGGCACGGCACGATTCGCGGCCGGAATCACCGGCTCGGTGACGGCGCTCTCCGCGCTGTGCCTCTTCTTCGCTGCGGCGAACTTCTTCTACTCGTCGGTGCCGTTGCACTTCGACATGGCACAGCGCATCGTCTCCGCCGTGCACGACTGGTCGTCGGTGAAGCTGGCGCTGGACCTCGGCTGCTGCGGCCGCGGCATCCTCCTGAACGCGGTGGCGACGCAGCTCAAGAAGGAAGGGAGCTCCGGCCGCGTCGTCGGCCTGGACCGCTCGAAGCGCACGACGCTGTCGACGCTGCGCGCGGCGAAGATGGAAGGCGTCGGCGAGTACGTGACGTGCCGCGAGGGCGACGCGCGGCGGCTGCCGTTTCCGGACAACTACTTCGACGTGGTTGTGTCCGGCGTGTTCGTGCACACCGAATTGAAGATGGAAGACGTGAGAGTCTCCGAGCGTGTAACCGCCTTCATGGTCAGCAGCCACATTGTATCATTCCGGAAGCCCAGTCAGCACGTGCATGGTCCCGCCGAAGTTCGCTTGGATTGGAGATTATGCTGA

>Glyma13g35670.2   sequence type=predicted peptide   gene model=Glyma13g35670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKSTNNNRDWTQMYAIYGMEQWQTLIFLLCQAMLFSVLSVLYLLYFDLVCSFFERIFSGGGGGTARFAAGITGSVTALSALCLFFAAANFFYSSVPLHFDMAQRIVSAVHDWSSVKLALDLGCCGRGILLNAVATQLKKEGSSGRVVGLDRSKRTTLSTLRAAKMEGVGEYVTCREGDARRLPFPDNYFDVVVSGVFVHTELKMEDVRVSERVTAFMVSSHIVSFRKPSQHVHGPAEVRLDWRLC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo