Glyma13g35161 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma13g35161

Feature Type:	gene_model
Chromosome:	Gm13
Start:	36646127
stop:	36651609
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma13g35161

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G53120	AT	Annotation by Michelle Graham. TAIR10: RNA-binding S4 domain-containing protein \| chr1:19792798-19794605 FORWARD LENGTH=320	SoyBase	E_val: 1.00E-69	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
UniRef100_B9T6N6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9T6N6_RICCO	SoyBase	E_val: 1.00E-68	ISS
UniRef100_C6TI80	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TI80_SOYBN	SoyBase	E_val: 3.00E-118	ISS

Expression Patterns of Glyma13g35161

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g35161 not represented in the dataset	Glyma13g35161 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g35161

Paralog	Evidence	Comments
Glyma12g35350	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g35161 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma13g35161

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma13g35161

Limit To All Plant Sequences

>Glyma13g35161.1   sequence type=CDS   gene model=Glyma13g35161   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCTGCAGCCTCTAGCTTTGGAACTACATGTCGTCTAAGAAGAGCAGCTCAGGCTTTTGCAATCTCTCATTCTCATATTCTCCGCAGCAATGCCAACCTTTCTTTGCAGAGGAACTTTTGCTCTCATCTCACCGTTTCTACTTCTTCAGCTTCTGGTGTAAGCCAGACAGTACAAGCTCTAAAGGGAGAAGTTGACTTGTTACTCAAGGGAGTAGGAGAAAGAAGTGTAATGAAAGAAGTAAAACATATCCTTGAGATGGCTAGACGAGCATCATTAAAGCGAGAGATTCTCCATACATATTTTCTAACCCCTCCAGTGCTAAAGGAATATATGCAAGTTTTGGAAAAACTAGCAGATGTGAAAGCAATTGCTCAAGGAGGTTACCCTCAGGCTGAATGTTGTCGGATTTCTGTTGGACATCCAGAAGAACTGGCCAGTGATCCAGATATTATTTCAGCATTAAGCATTACAAGAAACTTCCTGTTTGAACCTTGCTCGCATGGTGACTTCCTTGGCTCAATTCTTGGTACAGGAATTGTCAGGGAGAAACTCGGAGATATTATATTGCAGGCATCTTTTTATTTAAATTTATTACATGAAAGTTCTGTTTGA

Predicted protein sequences of Glyma13g35161

Limit To All Plant Sequences

>Glyma13g35161.1   sequence type=predicted peptide   gene model=Glyma13g35161   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAAASSFGTTCRLRRAAQAFAISHSHILRSNANLSLQRNFCSHLTVSTSSASGVSQTVQALKGEVDLLLKGVGERSVMKEVKHILEMARRASLKREILHTYFLTPPVLKEYMQVLEKLADVKAIAQGGYPQAECCRISVGHPEELASDPDIISALSITRNFLFEPCSHGDFLGSILGTGIVREKLGDIILQASFYLNLLHESSV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain