SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g35141): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g35141): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g35141

Feature Type:gene_model
Chromosome:Gm13
Start:36628992
stop:36636678
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G53130AT Annotation by Michelle Graham. TAIR10: Stigma-specific Stig1 family protein | chr1:19794947-19795453 REVERSE LENGTH=168 SoyBaseE_val: 3.00E-11ISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010193GO-bp Annotation by Michelle Graham. GO Biological Process: response to ozone SoyBaseN/AISS
GO:0010942GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell death SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0048316GO-bp Annotation by Michelle Graham. GO Biological Process: seed development SoyBaseN/AISS
GO:0080141GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0080142GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of salicylic acid biosynthetic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005615GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular space SoyBaseN/AISS
PF04885PFAM Stigma-specific protein, Stig1 JGI ISS
UniRef100_G7IRC0UniRef Annotation by Michelle Graham. Most informative UniRef hit: BIP1 n=1 Tax=Medicago truncatula RepID=G7IRC0_MEDTR SoyBaseE_val: 1.00E-19ISS
UniRef100_I1M372UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M372_SOYBN SoyBaseE_val: 1.00E-38ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g35141 not represented in the dataset

Glyma13g35141 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g35370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma13g35141.1   sequence type=CDS   gene model=Glyma13g35141   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTTATGCAATGAATATGACTGAGTGGTTTAGATGTAAAGTGGTACCAAACCCTCTGCATAACTCCCACTTTGTTGTTTCTTCAACTGATATAGATCAAGATCATGACATTAATGAAGAGGAGGAAGAAGATGACAAGAACAACTGCAGGGTGTGTGGCAACAAGTGCAAGCAAGGAGAAAGATGCTGTAATGGGGTTTGTACCAATGTGTTGTCCAATGCACGACACTGTGGCAAGTGCAACAAGCAGTGCTCACCTGGAGATTCATGTGGGAATGGGGTTTAA

>Glyma13g35141.1   sequence type=predicted peptide   gene model=Glyma13g35141   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPYAMNMTEWFRCKVVPNPLHNSHFVVSSTDIDQDHDINEEEEEDDKNNCRVCGNKCKQGERCCNGVCTNVLSNARHCGKCNKQCSPGDSCGNGV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo