SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma13g35000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma13g35000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma13g35000

Feature Type:gene_model
Chromosome:Gm13
Start:36512357
stop:36514531
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma13g35000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G53160AT Annotation by Michelle Graham. TAIR10: squamosa promoter binding protein-like 4 | chr1:19806478-19807080 FORWARD LENGTH=174 SoyBaseE_val: 1.00E-36ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0010321GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of vegetative phase change SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF03110PFAM SBP domain JGI ISS
UniRef100_B9T4B7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Squamosa promoter-binding protein, putative n=1 Tax=Ricinus communis RepID=B9T4B7_RICCO SoyBaseE_val: 1.00E-50ISS
UniRef100_I1M360UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M360_SOYBN SoyBaseE_val: 5.00E-133ISS

Expression Patterns of Glyma13g35000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma13g35000 not represented in the dataset
Glyma13g35000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma13g35000
ParalogEvidenceComments
Glyma12g35460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma13g35000 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g274900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma13g35000
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma13g35000
>Glyma13g35000.1   sequence type=CDS   gene model=Glyma13g35000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGATCAAGAGTGGAGAGAGGAGGCAAGTGTCAATTGAGAAGGTGAGGAGAGACAACACAGTTGAAGTAGAAGATGAAGAAGAGGAGGATGAAAGTGTGGTTGGTGGTGAGGGTGGTCTTGCAGAAGATGAAAGGAAGAAAATTGGTGGAGGAAGTGGGAGAAGAGGGTCAAGTGGAGTTTCTCCACCTTCTTGTCAGGCAGAGATATGTGGTGCTGATTTGACTGTTGCAAAGAGGTACCATCGCCGTCATAAGGTGTGTGAGCTTCATTCCAAGGCTCCTTCTGTGATGGTTGCAGGACTGAGGCAGAGGTTTTGCCAGCAATGTAGCAGGTTCCATGAGCTGGCAGAGTTTGATGAAGCTAAAAGAAGCTGCCGGAGACGCTTGGCCAGACACAACGAGCGGCGCCGGAAAAGCAACGCTGAAACTTGCAATGAAGGATGCAGTGGCAGCAAAGGGCAGCACCCTGCAGAAACCCACTGCAGAAATACTGATGACTGGGGAAGAATTCAGATGAACATTGCAAAGAATTCTGGCTACAAGTTCTTCCATATCAGATGA
Predicted protein sequences of Glyma13g35000
>Glyma13g35000.1   sequence type=predicted peptide   gene model=Glyma13g35000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEIKSGERRQVSIEKVRRDNTVEVEDEEEEDESVVGGEGGLAEDERKKIGGGSGRRGSSGVSPPSCQAEICGADLTVAKRYHRRHKVCELHSKAPSVMVAGLRQRFCQQCSRFHELAEFDEAKRSCRRRLARHNERRRKSNAETCNEGCSGSKGQHPAETHCRNTDDWGRIQMNIAKNSGYKFFHIR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo